KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1457Help
Entry
Cp31_1457         CDS       T02029                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp31_1457 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp31_1457 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    Cp31_1457 (aceF)
Enzymes [BR:cop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cp31_1457 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1623167..1624480
Genome map
AA seq 437 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKP
VDNQNVPYVTPLVRKLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGPEPAQKEAPAAV
KDPRANWSTKSVDPAKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVAT
LRKDNKPAFIEKYGVNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAV
DTERGLLTPVIHKAQELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALA
DTPILVPPQVGILGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTA
TIKDRLEKAKFQDDLNL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcaacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccaaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaaggaagaaccggctaaagaggctgcaaagcca
gtcgataaccaaaacgttccttatgtgaccccattggtacgcaagcttgctaataagtac
ggcgttgacctcaataaggtcgaaggcactggcgttggcggccgtatccgtaagcaagac
gttctcgccgcagccgggcaaggacctgagccggctcaaaaagaagcccctgctgctgtt
aaggatcctcgcgctaactggtccaccaagagcgttgatcctgcaaaggcagagcttatt
ggtaccacccagaaggtcaaccgcatccgcgagatcacggctaagaagatggtcgaggcg
ttgcagatttctgcacagctcacgcatcttcaagaggtggatatgaccaacgttgccacg
ctgcgcaaggacaacaagccggcattcatcgaaaagtatggcgttaacctgacctacctg
ccgttctttgttaaggccgtggttgaggctctagtcctgcacccgaacgtgaatgcgtct
tacaacgctgccaccaaggagatcacttaccactccgacgtcaatattgcgattgcagtg
gataccgagcgcggtctgctcacccctgtgatccacaaggcccaggagcttacgttgccg
gagatcgctcaggctattgttgatctggccgatcgcgcccgtaacaataagctgaagcca
aacgacctatccggcgcaaccttcactgtgaccaatatcggttccgagggtgccttggca
gataccccaatcttggttccaccgcaggttggtatcttgggcaccgctgcgatccagaag
cgcccagtggtaatcactgagaatggctcagacgccatcgcaatccgtcaaatgtgctac
atcccgttctcttatgatcaccagatcgtagacggcgctgatgccggtcgcttcaccgcg
acgatcaaggatcgcctggaaaaggctaagttccaggacgacctcaacctctaa

DBGET integrated database retrieval system