KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1784Help
Entry
Cp31_1784         CDS       T02029                                 

Gene name
folP1
Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cp31_1784 (folP1)
Enzymes [BR:cop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cp31_1784 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1924986..1925768)
Genome map
AA seq 260 aa AA seqDB search
MTEVMGIVNVTTDSFSDGGKYLDVDSAVAHAKKLVAEGADIIDVGGESTRPGATRVSEEV
ELARVIPVITALHAEGIKTSVDTMRASVAAAAAEAGVGLLNDVSGGLADKNMYSVMADTE
LPVCLMHWKTTTFGDASGAHHTDVVRDVREGLNLLVDNALAAGVDAQAIAIDPGLGFAKT
AEDNWALLNALPEFMSNYPVLLGASRKRFLASLGVDTDAATAAVTAIAAHHGVWCVRVHN
VALSRAAVDVAAKWRNHGSH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagtaatgggaatcgtcaacgtaaccaccgattccttttctgatggcgggaaa
tacctcgacgtagattccgccgtggctcatgccaaaaaacttgtggcagagggcgcagat
atcatcgacgtgggtggggaatccacccgcccaggggctactcgagtgagcgaagaagta
gagctcgctcgagttattcctgtcattacagctctgcatgctgaaggaattaaaacatcg
gtggacaccatgcgagcctcagtcgcggctgccgccgccgaggccggggtgggcttgctt
aacgacgtctccggtggtcttgcagacaagaatatgtattcagttatggctgataccgag
cttccggtgtgcctgatgcattggaagacaacaacctttggagatgcctcaggagcacac
cataccgatgtggtgcgcgatgtccgtgaaggcttgaacctgctcgttgacaatgccctt
gccgctggcgttgacgcgcaagctattgccattgacccgggtctcggttttgctaaaact
gcagaggacaattgggcattgctcaatgcccttccagaatttatgagcaactatccggtg
ttgctgggggcgtcgagaaagcgctttttagctagcctgggcgtagacacagacgctgct
actgccgcagtcaccgcaatcgctgctcatcatggagtgtggtgcgtccgggtgcacaat
gtggcgctatcccgtgctgccgtagatgttgcggcgaaatggaggaatcatggatcgcat
tga

DBGET integrated database retrieval system