KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1985Help
Entry
Cp31_1985         CDS       T02029                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp31_1985 (deoA)
Enzymes [BR:cop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp31_1985 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162903..2164189
Genome map
AA seq 428 aa AA seqDB search
MAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMAALNMAIFLNGMDREEIV
QWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDITATVDC
IPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDAGTNMVALL
TDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVHEALAD
GRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDGYLTEMDALALGVASWRLGAGRAR
KEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRALESLEPGVNIGDEPPAPRP
SVVLDRIS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagcta
agcaagggacaaatcgactggatcatcgacgcctacactcgcggcattgttggcgacgat
caaatggctgccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtc
cagtggacccaggccatgatcgactccggcgagaccatgagctttgccagcctctcccgg
ccaacaacagacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcg
ccactcgttgccagttacggcgttgccgtgccacaactctctggtagaggactaggacac
acaggcggaaccctagacaaattagaggccatccccgggtgggaagctgacatagataat
gcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggc
ctcgcacccgccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgc
atcccgctgatcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaaccta
gtcctcgacgtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgag
ctcgcccgcaccatggttgacctaggccgcgacgccggaaccaatatggtcgcgcttctc
accgacatgtccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtct
gtagaagtcctcgcaggcggtggcccttccgacgtcatagagctcacctgcgcccttgcg
acggagatgcttgagctcgccggcgtccatgaccccgatgtccacgaagcgcttgccgac
ggccgcgcgatggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgca
gcgctccccaccgcacggcacacccatgaggtcaccgccgatcgcgacggctatctcaca
gagatggacgccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgc
aaggaagatccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaag
gtttcaaagggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccga
gccctagaatccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccc
tcggtcgtccttgatcgcatcagctaa

DBGET integrated database retrieval system