KEGG   Corynebacterium pseudotuberculosis 31: Cp31_2087Help
Entry
Cp31_2087         CDS       T02029                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cop01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cop00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cop00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2272400..2273239
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLSIIRTAVSAGADALELGIPFSDPVAD
GPTIQRSHLRALDNGATVDSSLKLISHIRSEFPELPIGLLIYGNVPFTRGLDSFYQEFAA
AGADSILLPDVPVREGGAFIAAAQRARIAPIFIAPAQASEETLHAVATHSEGYIYAISRD
GVTGTERESSTSGLTDVVNNINKFGGAPVLLGFGISTPQHVREAIDAGARGVITGSAITA
IIERHCIGQHPAPATIDDMSALQSEIFAFISEMKAATRR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaatctttttacccggctagaacaatccaatgagggcgcctttgtt
ccctttatcatgcttggagaccccagccctgaagcatcattatcaatcatccgtaccgcc
gtcagtgccggcgcagacgcccttgagcttgggatcccattctcagacccagtagctgac
gggcctaccattcagcgttctcatctccgcgccctggataatggggcaacggttgattcc
tcattaaagctcatctctcacattcgttcagaattccccgaactacccatcggcctcttg
atttatggcaacgttccttttacccgtggactagatagcttctatcaagaatttgccgca
gccggcgccgattccattttgcttcccgacgttcccgtgagggaggggggagccttcatc
gcagcggcacagagagcgagaatcgcacccattttcatcgccccggcacaggcttctgaa
gagaccctccatgcagtagcaacacattccgagggatacatctatgcaatttctcgtgat
ggagttaccggaacggaacgagaatcttccaccagtggtctcaccgatgtggtaaacaac
atcaataaattcggcggagcgccggtacttctagggttcggaatttccacgcctcagcat
gtccgtgaagcgatagatgccggcgccaggggagtaatcactggatccgcaatcactgcg
attattgaaagacactgcatcggccaacatcctgcacccgcaacaatcgatgacatgtct
gcactgcaatcggagattttcgctttcatctcagaaatgaaagcggcgacccgcagataa

DBGET integrated database retrieval system