KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0155Help
Entry
Cp267_0155        CDS       T01934                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cp267_0155 (recR)
DNA repair and recombination proteins [BR:cor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cp267_0155 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150500..151156
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDALGAVRDGVTFCRICC
NISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgcttcaggaccttattgatgagctttcacggctccccggcgtgggc
cctaaatctgctcaacgcatcgcttttcacttgcttcatgtggagcctgcggacatcgca
agacttcaggatgccctcggtgctgtccgagatggcgtgaccttttgtcgtatttgctgc
aatatctcccgcgaatcggtatgccgtatttgtgcggattctggccgggatcggggaacg
atctgcgtggtggaggaacccaaagatattcaggttattgagcggacgggcgaatataat
ggccgctaccatgtgctgggtggggcgttggatccgctagctaatattggtccccgtgaa
ctgaatatttctacgttgctgcagcgcattggaggggtgcttcctgatcgagagctagcg
gattctacgcctgatgcgccgctgtatgattcctctccgacggtgacagaggttattctt
gccaccgaccccaataccgagggtgaggcgacggcttcttatcttgcacgtctgctccga
gattttcctgatttggtggtttctcgtctggcttccggtatgcctttgggcggggaccta
gaatttgtggatgaactgacattgtcccgcgccctgagcggtcgattgacaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system