KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0504Help
Entry
Cp267_0504        CDS       T01934                                 

Gene name
rbsK
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cp267_0504 (rbsK)
Enzymes [BR:cor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cp267_0504 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(504175..505101)
Genome map
AA seq 308 aa AA seqDB search
MLKTVAVIGSINADLSVRVHRPPTPGETVLGMDSSISPGGKGANQAVAAALQGAKVVFIG
AVGKDSYAEPAMELLRASSVSLEHVSAVDGPTGSAVITVSDDGENSIIVIPGANAAVDAA
YVAKNAEAIAGADIVLLQGEIPADGFLEAIKAATGRIVVNLAPVISVDREALLKADPLMA
NEHEANLILEQLGSSISSDDPHELAQELLAQGFASVVLTLGSKGALVADPQASVIVPSPK
VTAVDTTGAGDAFAGAFVAQLLSGASSVEAAQHAVRVAAYAVQYRGTQVSYPNAGAELPS
WREIRCKE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagactgttgccgtcataggctccatcaatgcagatttgagcgtgcgtgttcac
cggcctcctacgccgggagagaccgtcctcggcatggatagttccatttctcccggtgga
aaaggcgcgaatcaggcagtagcagcagcactccaaggtgcaaaagttgtcttcatcggc
gctgtaggtaaagattcctacgccgaacctgctatggagttgctgcgcgcctccagcgta
tctctagaacatgtctcggctgtcgacggccccacgggcagcgcagtaatcacagtttct
gatgacggagagaactccatcatcgtgatccctggcgcaaatgctgctgtcgacgccgct
tatgtggccaaaaatgcagaagctatcgcaggtgcggatatcgtacttcttcagggagag
attcctgccgatggattcctcgaagcgataaaagcagcaactggtcgcattgtggtcaac
cttgctcccgttatatccgtggatcgtgaagctttgctcaaagcagacccactcatggct
aacgagcatgaagccaacctcattctggagcaactgggcagcagcatcagcagcgatgac
ccgcacgagctcgctcaagaattgttagcccagggttttgcctcggttgttctcactcta
ggtagtaaaggcgcgcttgtggcagatcctcaggccagcgtcatagttccgtcaccaaag
gtaaccgcagtggacacaactggagctggggatgccttcgctggcgcctttgtggctcaa
ttgctcagcggagcgtcttctgtagaagctgcacagcacgccgtccgggtcgccgcctat
gccgtgcagtatcgaggcacccaggtctcctaccctaacgcgggcgccgaactcccgagt
tggagggaaataagatgtaaggaatga

DBGET integrated database retrieval system