KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0639Help
Entry
Cp267_0639        CDS       T01934                                 

Gene name
echA6
Definition
Enoyl-CoA hydratase echA6
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cor01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cor00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cor00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cor00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cor00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cor00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:cor00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cor00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cor00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:cor00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cor00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647093..647779
Genome map
AA seq 228 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALSSGFVAIRGDHAAAVAFAHEVAGLAPLSVR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggtgctgggatgcagcttgct
ttggcgtgtgatctccgtgttgttggagagtctgcatggtttaaagtccccgctgtttct
ttggggtttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcattgaccccggatgcggctctgtctagt
ggttttgttgcaatccggggcgaccatgctgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggtag

DBGET integrated database retrieval system