KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0639Help
Entry
Cp267_0639        CDS       T01934                                 

Gene name
echA6
Definition
Enoyl-CoA hydratase echA6
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cp267_0639 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp267_0639 (echA6)
   00650 Butanoate metabolism
    Cp267_0639 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp267_0639 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp267_0639 (echA6)
   00310 Lysine degradation
    Cp267_0639 (echA6)
   00360 Phenylalanine metabolism
    Cp267_0639 (echA6)
   00380 Tryptophan metabolism
    Cp267_0639 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp267_0639 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp267_0639 (echA6)
   00281 Geraniol degradation
    Cp267_0639 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp267_0639 (echA6)
   00627 Aminobenzoate degradation
    Cp267_0639 (echA6)
   00930 Caprolactam degradation
    Cp267_0639 (echA6)
Enzymes [BR:cor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp267_0639 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
647093..647779
Genome map
AA seq 228 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALSSGFVAIRGDHAAAVAFAHEVAGLAPLSVR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggtgctgggatgcagcttgct
ttggcgtgtgatctccgtgttgttggagagtctgcatggtttaaagtccccgctgtttct
ttggggtttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcattgaccccggatgcggctctgtctagt
ggttttgttgcaatccggggcgaccatgctgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggtag

DBGET integrated database retrieval system