KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0698Help
Entry
Cp267_0698        CDS       T01934                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
cor00040  Pentose and glucuronate interconversions
cor00052  Galactose metabolism
cor00500  Starch and sucrose metabolism
cor00520  Amino sugar and nucleotide sugar metabolism
cor01100  Metabolic pathways
cor01130  Biosynthesis of antibiotics
Module
cor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cp267_0698 (galU)
   00052 Galactose metabolism
    Cp267_0698 (galU)
   00500 Starch and sucrose metabolism
    Cp267_0698 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp267_0698 (galU)
Enzymes [BR:cor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cp267_0698 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFH51600
Position
704187..705116
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPAYGPHLKKVL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgtcgcggtgaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttcctgccacaaaaacggttcctaaagaactg
ttaccagtggtagataccccaggcattgaactgattgcagaagaagcagctcagttgggg
gcaactcgactcgcagtaattacggctcctaataagcaggaagtcatggagcactttaag
cgattcccagtgttggaagagaccctacaaagccggggcaaaaccgaacaatatgaaaaa
gttgttcatgcctctgagcttattgcgccagtttccgtagtgcaggaaaagccgctcggc
cttgggcatgctgttggcatggcggaatcagtccttgatcctgatgaggatgccgtagca
gtcatgcttcccgatgatctagtgcttccgcggggcgttgtggagaagatggtcgaggta
cgcgagcaactaggcggatccgtgttgtgcgcctttgaagtgccggaggaagaagtctat
aactacggtgtctttgagatcgatgagagtgcatatgatggccctcatcacgtcaaaaaa
gtcaaaggaatggtagaaaaaccctctgtagaagaggctccttcaaattttgtggctacc
ggccgctatttgctcgatcgggctatttttgatgcactccgtagaattaccccgggtgct
ggcggtgagctgcaactcacggatgccattgatttgcttatcgacgaaggccatcctgtg
catattcttgtgcatgacgggaagcgtcatgatcttggcaaccccgggggatacataccg
gctgttgttgattttgggttgcgcgatccagcgtatgggccgcacttaaagaaggtcctc
cgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system