KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0932Help
Entry
Cp267_0932        CDS       T01934                                 

Gene name
serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp267_0932 (serA)
   01230 Biosynthesis of amino acids
    Cp267_0932 (serA)
  Energy metabolism
   00680 Methane metabolism
    Cp267_0932 (serA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp267_0932 (serA)
Enzymes [BR:cor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Cp267_0932 (serA)
Exosome [BR:cor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cp267_0932 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
955261..956856
Genome map
AA seq 531 aa AA seqDB search
MSQNGRPVVLIADKLAQSTVDALGDSVEVRWVDGPNREELLAAVTDADALLVRSATTVDK
EVFDAAAKLKIVGRAGVGLDNVDIAAATERGVMVVNAPTSNIHSACEHAISLLLATARQI
PAADASLRGQEWKRSSFTGVEIYGKTIGIVGFGHIGQLFAHRLAAFETTIIAYDPYANPA
RAAQLGVELVDLEELMGRADFVTIHLPKTPETQGMFDAELLAKSKPGQIIVNAARGGLVN
EQALADAIMSGHIRGAGFDVFATEPCTDSPLFALPQVVVTPHLGASTVEAQDRAGTDVAE
SVLKALAGEFVPDAVNVSGGRVGEEVSLWLDLARKLGLVAGKLLDKAAVSLEVEARGELS
TEDVDALGLSALRGLFSAVIEEPVTFVNAPRIAEERGVKLDVTTASESLTHRSVLEVRAI
GTDGEAVSVIGALTGLDHVEKIVRINKRGLDLRAHGFNVFFQYTDTPGVLGKVGTAFGAA
GFNIDAAAMSQNSDGTGSTLVLRIDKPAAESLVETIAESIEAESFAVDFDA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagaatggccgacctgtcgttctaattgcagacaaacttgcacagtccactgtt
gatgctctgggtgattcagttgaagtccgatgggtcgatgggcccaacagggaagaatta
cttgcggcggtgaccgatgcagacgcactgctggtgcgctcggcaaccactgtggataaa
gaagtctttgatgccgcagcaaagcttaagatcgtcggccgcgcgggcgttggattggac
aacgtagacatcgcagccgctactgaacgtggggtcatggttgttaacgctcctacctca
aacattcactctgcgtgtgagcacgctatttcccttttgctcgctactgccaggcaaata
cctgctgccgatgcatctcttcgaggacaagaatggaagcgatcctcctttaccggggtg
gaaatttacgggaaaaccataggaattgttggatttggtcacatcggtcagctttttgcc
caccgactcgcagcctttgaaaccacgattatcgcttatgacccttacgcaaaccccgct
cgagccgctcagctcggcgtggaattggttgacctagaagaactgatggggcgtgcggac
tttgttacaatccatcttcctaaaactccggaaacccaagggatgtttgacgcggagcta
ttggctaaatccaagccgggtcaaatcattgtcaatgcggcccgtggcggcctggtcaat
gagcaggcgcttgccgacgccatcatgtcggggcacatccgtggcgcaggctttgatgtg
tttgctactgagccgtgtacagactcgccattatttgcgctgccgcaggtcgtggtcacc
ccgcatctgggggcctcgaccgtggaagcgcaagatcgtgcggggacagatgtagcagaa
tcggtgctaaaagcactggccggtgagtttgttccggatgcggtgaacgtgtccggcgga
cgcgtcggtgaagaagtctcgctatggctagacctggctaggaagctggggctcgttgct
ggcaaacttctggataaagccgctgtttctctggaagttgaggcccgtggtgagctttcc
acagaagacgttgacgcactgggactatctgccctgcgtggtttgttctctgcggtaata
gaagaacctgtcacttttgtgaatgctccgagaattgctgaagagcggggagtaaaactc
gatgtaactacagccagtgaatctcttacgcaccgttctgttcttgaagtaagggctatc
ggcacagatggtgaagcggtatctgtgatcggagccctcactggccttgatcatgtggag
aagatcgtgcggattaacaaacgtggactagatctgcgggcacatggtttcaacgtcttc
tttcaatacactgatacccctggtgttctggggaaagttggaactgccttcggcgcagct
ggctttaatatcgacgctgccgcaatgtctcaaaactctgatggaacgggctcaacgctt
gtgcttcgcatagataagcctgccgcggaatcattagtggaaacaattgcggagtcaatt
gaggcagaatcttttgccgtagattttgacgcttaa

DBGET integrated database retrieval system