KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0932Help
Entry
Cp267_0932        CDS       T01934                                 

Gene name
serA
Definition
D-3-phosphoglycerate dehydrogenase
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Class
Metabolism; Overview; Carbon metabolism [PATH:cor01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cor01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:cor00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cor00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955261..956856
Genome map
AA seq 531 aa AA seqDB search
MSQNGRPVVLIADKLAQSTVDALGDSVEVRWVDGPNREELLAAVTDADALLVRSATTVDK
EVFDAAAKLKIVGRAGVGLDNVDIAAATERGVMVVNAPTSNIHSACEHAISLLLATARQI
PAADASLRGQEWKRSSFTGVEIYGKTIGIVGFGHIGQLFAHRLAAFETTIIAYDPYANPA
RAAQLGVELVDLEELMGRADFVTIHLPKTPETQGMFDAELLAKSKPGQIIVNAARGGLVN
EQALADAIMSGHIRGAGFDVFATEPCTDSPLFALPQVVVTPHLGASTVEAQDRAGTDVAE
SVLKALAGEFVPDAVNVSGGRVGEEVSLWLDLARKLGLVAGKLLDKAAVSLEVEARGELS
TEDVDALGLSALRGLFSAVIEEPVTFVNAPRIAEERGVKLDVTTASESLTHRSVLEVRAI
GTDGEAVSVIGALTGLDHVEKIVRINKRGLDLRAHGFNVFFQYTDTPGVLGKVGTAFGAA
GFNIDAAAMSQNSDGTGSTLVLRIDKPAAESLVETIAESIEAESFAVDFDA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagaatggccgacctgtcgttctaattgcagacaaacttgcacagtccactgtt
gatgctctgggtgattcagttgaagtccgatgggtcgatgggcccaacagggaagaatta
cttgcggcggtgaccgatgcagacgcactgctggtgcgctcggcaaccactgtggataaa
gaagtctttgatgccgcagcaaagcttaagatcgtcggccgcgcgggcgttggattggac
aacgtagacatcgcagccgctactgaacgtggggtcatggttgttaacgctcctacctca
aacattcactctgcgtgtgagcacgctatttcccttttgctcgctactgccaggcaaata
cctgctgccgatgcatctcttcgaggacaagaatggaagcgatcctcctttaccggggtg
gaaatttacgggaaaaccataggaattgttggatttggtcacatcggtcagctttttgcc
caccgactcgcagcctttgaaaccacgattatcgcttatgacccttacgcaaaccccgct
cgagccgctcagctcggcgtggaattggttgacctagaagaactgatggggcgtgcggac
tttgttacaatccatcttcctaaaactccggaaacccaagggatgtttgacgcggagcta
ttggctaaatccaagccgggtcaaatcattgtcaatgcggcccgtggcggcctggtcaat
gagcaggcgcttgccgacgccatcatgtcggggcacatccgtggcgcaggctttgatgtg
tttgctactgagccgtgtacagactcgccattatttgcgctgccgcaggtcgtggtcacc
ccgcatctgggggcctcgaccgtggaagcgcaagatcgtgcggggacagatgtagcagaa
tcggtgctaaaagcactggccggtgagtttgttccggatgcggtgaacgtgtccggcgga
cgcgtcggtgaagaagtctcgctatggctagacctggctaggaagctggggctcgttgct
ggcaaacttctggataaagccgctgtttctctggaagttgaggcccgtggtgagctttcc
acagaagacgttgacgcactgggactatctgccctgcgtggtttgttctctgcggtaata
gaagaacctgtcacttttgtgaatgctccgagaattgctgaagagcggggagtaaaactc
gatgtaactacagccagtgaatctcttacgcaccgttctgttcttgaagtaagggctatc
ggcacagatggtgaagcggtatctgtgatcggagccctcactggccttgatcatgtggag
aagatcgtgcggattaacaaacgtggactagatctgcgggcacatggtttcaacgtcttc
tttcaatacactgatacccctggtgttctggggaaagttggaactgccttcggcgcagct
ggctttaatatcgacgctgccgcaatgtctcaaaactctgatggaacgggctcaacgctt
gtgcttcgcatagataagcctgccgcggaatcattagtggaaacaattgcggagtcaatt
gaggcagaatcttttgccgtagattttgacgcttaa

DBGET integrated database retrieval system