KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0932Help
Entry
Cp267_0932        CDS       T01934                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
cor00260  Glycine, serine and threonine metabolism
cor00680  Methane metabolism
cor01100  Metabolic pathways
cor01120  Microbial metabolism in diverse environments
cor01130  Biosynthesis of antibiotics
cor01200  Carbon metabolism
cor01230  Biosynthesis of amino acids
Module
cor_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Cp267_0932 (serA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp267_0932 (serA)
Enzymes [BR:cor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Cp267_0932 (serA)
    1.1.1.399  2-oxoglutarate reductase
     Cp267_0932 (serA)
Exosome [BR:cor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cp267_0932 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 IlvN GFO_IDH_MocA Sacchrp_dh_NADP F420_oxidored ApbA AdoHcyase_NAD UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: AFH51832
Position
955261..956856
Genome map
AA seq 531 aa AA seqDB search
MSQNGRPVVLIADKLAQSTVDALGDSVEVRWVDGPNREELLAAVTDADALLVRSATTVDK
EVFDAAAKLKIVGRAGVGLDNVDIAAATERGVMVVNAPTSNIHSACEHAISLLLATARQI
PAADASLRGQEWKRSSFTGVEIYGKTIGIVGFGHIGQLFAHRLAAFETTIIAYDPYANPA
RAAQLGVELVDLEELMGRADFVTIHLPKTPETQGMFDAELLAKSKPGQIIVNAARGGLVN
EQALADAIMSGHIRGAGFDVFATEPCTDSPLFALPQVVVTPHLGASTVEAQDRAGTDVAE
SVLKALAGEFVPDAVNVSGGRVGEEVSLWLDLARKLGLVAGKLLDKAAVSLEVEARGELS
TEDVDALGLSALRGLFSAVIEEPVTFVNAPRIAEERGVKLDVTTASESLTHRSVLEVRAI
GTDGEAVSVIGALTGLDHVEKIVRINKRGLDLRAHGFNVFFQYTDTPGVLGKVGTAFGAA
GFNIDAAAMSQNSDGTGSTLVLRIDKPAAESLVETIAESIEAESFAVDFDA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagaatggccgacctgtcgttctaattgcagacaaacttgcacagtccactgtt
gatgctctgggtgattcagttgaagtccgatgggtcgatgggcccaacagggaagaatta
cttgcggcggtgaccgatgcagacgcactgctggtgcgctcggcaaccactgtggataaa
gaagtctttgatgccgcagcaaagcttaagatcgtcggccgcgcgggcgttggattggac
aacgtagacatcgcagccgctactgaacgtggggtcatggttgttaacgctcctacctca
aacattcactctgcgtgtgagcacgctatttcccttttgctcgctactgccaggcaaata
cctgctgccgatgcatctcttcgaggacaagaatggaagcgatcctcctttaccggggtg
gaaatttacgggaaaaccataggaattgttggatttggtcacatcggtcagctttttgcc
caccgactcgcagcctttgaaaccacgattatcgcttatgacccttacgcaaaccccgct
cgagccgctcagctcggcgtggaattggttgacctagaagaactgatggggcgtgcggac
tttgttacaatccatcttcctaaaactccggaaacccaagggatgtttgacgcggagcta
ttggctaaatccaagccgggtcaaatcattgtcaatgcggcccgtggcggcctggtcaat
gagcaggcgcttgccgacgccatcatgtcggggcacatccgtggcgcaggctttgatgtg
tttgctactgagccgtgtacagactcgccattatttgcgctgccgcaggtcgtggtcacc
ccgcatctgggggcctcgaccgtggaagcgcaagatcgtgcggggacagatgtagcagaa
tcggtgctaaaagcactggccggtgagtttgttccggatgcggtgaacgtgtccggcgga
cgcgtcggtgaagaagtctcgctatggctagacctggctaggaagctggggctcgttgct
ggcaaacttctggataaagccgctgtttctctggaagttgaggcccgtggtgagctttcc
acagaagacgttgacgcactgggactatctgccctgcgtggtttgttctctgcggtaata
gaagaacctgtcacttttgtgaatgctccgagaattgctgaagagcggggagtaaaactc
gatgtaactacagccagtgaatctcttacgcaccgttctgttcttgaagtaagggctatc
ggcacagatggtgaagcggtatctgtgatcggagccctcactggccttgatcatgtggag
aagatcgtgcggattaacaaacgtggactagatctgcgggcacatggtttcaacgtcttc
tttcaatacactgatacccctggtgttctggggaaagttggaactgccttcggcgcagct
ggctttaatatcgacgctgccgcaatgtctcaaaactctgatggaacgggctcaacgctt
gtgcttcgcatagataagcctgccgcggaatcattagtggaaacaattgcggagtcaatt
gaggcagaatcttttgccgtagattttgacgcttaa

DBGET integrated database retrieval system