KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1156Help
Entry
Cp267_1156        CDS       T01934                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
cor00010  Glycolysis / Gluconeogenesis
cor00051  Fructose and mannose metabolism
cor00562  Inositol phosphate metabolism
cor01100  Metabolic pathways
cor01110  Biosynthesis of secondary metabolites
cor01120  Microbial metabolism in diverse environments
cor01130  Biosynthesis of antibiotics
cor01200  Carbon metabolism
cor01230  Biosynthesis of amino acids
Module
cor_M00002  Glycolysis, core module involving three-carbon compounds
cor_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp267_1156 (tpiA)
   00051 Fructose and mannose metabolism
    Cp267_1156 (tpiA)
   00562 Inositol phosphate metabolism
    Cp267_1156 (tpiA)
Enzymes [BR:cor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cp267_1156 (tpiA)
Exosome [BR:cor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cp267_1156 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cp267_1156 (tpiA)
  Exosomal proteins of melanoma cells
   Cp267_1156 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFH52055
Position
complement(1207694..1208473)
Genome map
AA seq 259 aa AA seqDB search
MERKPLIAGNWKMNLDHMQAVATVQKLAFALPAEYYEKVDVAVTVPFTDLRSVQTVIDGD
KLQITYGAQDVSEHESGAYTGEISAAMLAKLGCTWVVVGHSERREYHDESSKLVAAKAKA
ALSKDISPIVCVGEPLTIREAGTHVDFVVEQTRESLAGLTEDELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIKELANEKIAAGIRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagccgctcatcgccggtaactggaagatgaatttagaccacatgcaagct
gtggcaacggttcagaagttagcgtttgcacttcctgccgaatactacgagaaagtggat
gtcgcagttactgtaccgttcacagatctacggtctgtccagactgtgattgatggagat
aaacttcagatcacgtacggcgcccaagatgtatcagagcatgaatcgggcgcttacact
ggagaaatctctgcagctatgcttgcaaagcttggctgtacatgggttgtggtggggcac
tcggagcgccgtgagtaccatgatgaatcttcgaaacttgttgcggcgaaggctaaagca
gcactgagcaaagatataagccctatcgtttgcgtcggtgagcccctaacgatccgggaa
gcaggaactcacgtagatttcgtcgtggagcaaacccgtgagtcgcttgcaggcctgacc
gaagacgagcttgctaagaccgttatcgcttatgagccggtttgggcaatcggtaccggg
aaggttgcttctgctgctgatgcccaagaggtgtgtaaagcaatccgcggtttgattaaa
gaacttgccaacgagaaaatcgccgcaggaattcgtatcctgtatggcggttctgtaaaa
gaagagacagtagcagagatcgtcggacaacccgatgtagatggtgggcttgtcggcggt
gcttctcttgatggcgaggcatttgccaagcttgcagctaatgcagctaccggtctttaa

DBGET integrated database retrieval system