KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1391Help
Entry
Cp267_1391        CDS       T01934                                 

Gene name
mutM1
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cor03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1466278..1467135)
Genome map
AA seq 285 aa AA seqDB search
MPELPEVEVVRRGLERHAVGRALTSVAVSHSRAARYVVGGPQELEARLRGRVLSSVHRRG
KFLWFVLDDSCALMVHLGMSGQMLIKQADASLHPHTRIRCSLSSGSEQSELWFVDQRTFG
YWRIAELVYSHNRLVPKPMAHIAADLLEPAQDLMATARLIKTKHLEIKRLLLNQEIVAGI
GNIYADEMLWSAQIHPRQKAHRLSLRAIHSLLNEGQRVMHNALLQGGTSFDSLYVNVNGE
SGYFDVSLQAYGQEGMPCTRCGTALVREKFSNRSSHFCPRCQRLQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagttgccagaggtagaggttgttcgccggggacttgaacgccatgccgttggg
agggcgttaacttctgtggcagtctcacattctcgtgctgcacgctatgtagtaggcggc
cctcaggagcttgaggcgcggctacgcggacgagtgctttcctcggtgcatcggcgcgga
aagtttttgtggtttgttttggatgactcttgtgcacttatggtgcatctgggtatgagt
gggcagatgcttattaagcaagctgatgcctcattgcatcctcatacccggattcgctgt
tctcttagttctggaagcgaacagagcgaattatggtttgtggatcagcgtacgtttggc
tattggagaatcgccgaattggtctattcccataatcgattagttcctaagccaatggcc
cacatagcagccgatctattggaacccgcgcaagatcttatggcgacagcgcgactgatt
aaaactaaacatttagagattaaaagactgcttcttaatcaagagattgttgcgggaatc
ggtaatatatacgcagatgagatgctgtggtctgcgcaaatacaccctaggcagaaggcg
cacaggctttcattacgtgcgattcactcgctcttaaacgaaggacaaagagtgatgcat
aatgctctgctgcaaggaggaacaagttttgattcgctgtatgtcaatgtgaatggcgaa
tctggctattttgatgtttctttgcaggcttatggccaagaaggaatgccttgcacgcga
tgcggtacagcgttggtgcgggaaaagttttccaatcgttcaagtcacttttgtccacga
tgccagcggctgcaatag

DBGET integrated database retrieval system