KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1417Help
Entry
Cp267_1417        CDS       T01934                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cor01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cor00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493483..1494808)
Genome map
AA seq 441 aa AA seqDB search
MLSLIDLRGHAPTTSELRRALPRGGTDVNSVTHIVEPVLHKIQEHGAQAALDFGEKFDRV
RPASVRVPQDVIDAALESLSPEVKQALEEAIARVRKVHADQKPQEHATKLDTGAIVTEVF
LPVERVGLYVPGGNAVYPSSVVMNVVPAQEAGVTSLVVASPPQADFGGWPHPTILAAAKL
LGVAEVWAVGGAQAVGLLAYGDDSEGLEPVDMITGPGNIFVTAAKRLVNGVVGIDSEAGP
TEIAIVADESANPVWIAYDLISQAEHDVLAASVLITDSEILAERVNAEVKSRFEITRNSD
RVVQALQGKQSGIVLVDDMATALTVADAYAAEHLEIHTANAQEDARKIRNAGAIFVGGFS
PVPLGDYAAGSNHVLPTSGSARYSSGLSTHTFLRAVNLIEYDETALKGISDTIVALANAE
ALPAHGEAIRSRFENLIAEQI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcctgatcgatctacgcggacatgcccctactactagtgaactccgtcgtgcc
ctcccacgcggaggcactgacgttaactccgtaacacatattgttgagccagttctgcat
aagatccaagaacacggagcccaggcagcccttgattttggtgaaaaatttgatcgcgtt
aggccagcaagcgtgagggttcctcaagacgtgattgatgctgctctggagtctttgtct
cctgaggtaaagcaggcgctcgaagaagcgattgctcgagtgcgcaaagtgcacgctgat
caaaagccgcaggaacatgcgacaaagcttgatacgggggccattgttacagaagtattt
cttcctgttgaacgcgtagggctatacgtcccgggtggtaatgcggtgtatccctcaagc
gttgttatgaacgtagttcccgcgcaggaggctggcgttacgtctttagttgtggcctcg
ccacctcaagctgactttggtggttggcctcatccgacgattctcgccgctgcgaaattg
ctgggggttgctgaagtatgggcggttgggggcgcacaggcggtaggactgctagcctat
ggcgatgattccgaggggttggagcctgtggatatgattactggccccggtaacattttt
gttactgcggccaaacgcctggtcaatggtgtagttggtattgattcagaagctgggcca
actgaaattgccatcgtagctgatgagagcgctaacccagtatggatagcatacgatctt
attagccaggcggagcatgatgttttagccgcctcggtgttgatcacggattctgagatc
ctcgcagaacgcgtgaatgctgaagtgaagtctcgatttgaaattacgcgtaattcagac
cgggttgtacaggccctccaaggaaaacaatcgggcattgtgcttgtcgacgatatggcg
accgcacttactgtcgccgatgcctatgcggcagagcacttggagattcatacagcgaat
gcccaagaggacgctcgtaagatacgcaacgcaggcgctatctttgtcggaggcttttca
ccggttccgcttggagattatgcggcaggttctaatcacgttcttccgacgtcggggagc
gcacgttacagctcagggctttccacacatacgttccttcgcgcggtgaatctcattgaa
tatgatgagaccgccttaaagggtatttcggatactatcgttgcgcttgccaacgcagag
gcgcttcctgcacatggagaagctattcgttccagatttgaaaacctcattgcagagcaa
atttga

DBGET integrated database retrieval system