KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1598Help
Entry
Cp267_1598        CDS       T01934                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cp267_1598 (malQ)
Enzymes [BR:cor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cp267_1598 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1680752..1682938
Genome map
AA seq 728 aa AA seqDB search
MGYTELLRELAAAHAVSCSFTGFGGEVTEVSDDTLVKTLRALGVRFGNEPGDSPNDHMPL
DAPMPSEEQIRAAIQKRRDEEDTRPLPRCVVATQGDPYVFNVHVHDGSPADITITLEDGS
VAADVTQIENWTPPRTVDGITWGEASFQIPQDLPLGWHTITLTSDTLTASCFLIITPQQL
STARTFVENPATGVMAQLYSVRSNDSWGMGDFHDLGELAKVVADKADADYILVNPMHAAE
PFPPVEDSPYLPTTRRFINPIYIRVEDIPEYLSLNDELQKEIEEISSEFKALNHSSDKIE
RNPIYDAKLQVLHAIFEAERDPAREQDFRDFVASEGDGLYDFALWCADQEIAHLTASSSH
AAIPAPEEAAEFYMWLQWICDQQLGAAQSAAIDAGMSIGIIADLAVGIHPGGADAQSLAD
SLAPRASVGAPPDNYNQQGQDWSQPPWHPDRLAEAGYVPWRDLLRTVLRHAGGIRVDHIL
GLFRLFWIPRMQSPTTGAYVNYDHNALVGVLALEAERAGAVVIGEDLGTYEPWVQEFLAQ
RGIMGTSVLWFESSPTGGPRHQNEYRELALSSVTTHDLPPTAGLLAGEHIELRKELGILT
VDPEQEHEQDIRWQNEILDEVKHTGAFSGATVPEAFQGLNREERGSADTLIPAIHKFLAG
TPSALTCTSLVDLVGDRRAQNQPGTTSDMYPNWCIPLCDGNIQALTIEEIADLPLFQAVA
DASKRNKR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgggttatacagaattgctgcgcgaactcgcagcagcacatgcagtttcttgttcattt
accggattcggcggcgaagtaaccgaagtcagcgacgatacgctggttaaaacacttcgt
gcgttgggtgttcgctttggaaatgaacccggggacagtccaaacgatcacatgccgctc
gatgctcctatgccgagcgaggaacagatccgtgcagctattcagaagcgccgcgatgaa
gaagacacgcgcccgcttccccgctgcgtcgtcgctacgcaaggagacccttacgtcttc
aacgtacatgttcacgacggctcccccgcagacatcacaatcacgcttgaagacggctca
gtcgcagcagacgtcacccaaattgaaaactggacaccaccgcgcactgtcgacggcatc
acatggggcgaagcctctttccagatcccacaggatctccccttaggctggcacaccatc
acgctgacctccgacacgctcactgccagctgtttcctcattatcaccccgcagcagctc
tccaccgcgcgcacgtttgtggagaacccagccactggagttatggctcagctctattca
gtgcgcagcaatgactcgtggggaatgggagacttccatgacctcggcgagttggccaaa
gttgtggccgacaaagctgacgctgactatattttggtcaacccgatgcatgcagccgag
cccttcccgccagtcgaggactccccttatctccccaccacgcgacgctttattaatccc
atctacatccgcgtggaggacatacccgagtacctcagccttaacgatgagttgcaaaag
gaaatcgaggagatttcttctgagtttaaggctctcaaccactccagcgataaaattgaa
cgcaacccgatctatgacgcaaagctccaagtgcttcatgcaatttttgaggccgagcgc
gatccggcacgtgaacaggacttccgcgattttgtagcctctgaaggtgatggcctctac
gacttcgcgttgtggtgtgcagatcaagaaatcgctcaccttacggcatccagctcccat
gctgctatccccgctccagaggaggccgcagaattctacatgtggcttcagtggatctgc
gatcagcagctgggtgcagcgcaatcagctgctatcgacgcaggcatgagcataggaatc
atcgccgacctcgccgtggggatccaccctggcggtgccgacgcccaaagccttgccgac
tctctagcgccacgcgcatccgtcggcgccccgcctgataattacaatcagcaaggacaa
gactggtctcagccaccatggcatcccgaccgtcttgctgaagccggctacgtgccatgg
cgcgatctgcttcgcaccgtcctgcgtcatgccggaggtattcgagtagaccatatccta
gggcttttccgtctcttctggatcccccgcatgcaatcccccaccaccggggcttatgtc
aactacgaccacaatgctctggtcggcgttctcgcgcttgaagcagagcgtgctggcgca
gtagtgataggtgaggacttaggcacatacgagccatgggttcaggagttccttgcacaa
cgcggaatcatgggcacatcggtgctttggtttgagagttcccccacgggtgggccgcgg
caccaaaacgaataccgcgagctcgcgctatcctccgtgaccacgcacgatcttcctcct
accgcgggacttcttgctggcgagcacatcgagttgcgtaaagagctcggtattcttacc
gtcgatcctgagcaagagcatgaacaagatattcgttggcaaaacgagattctcgacgaa
gtcaagcacaccggtgccttctccggggccacagtgccagaggctttccaagggctcaat
agggaagaacgaggaagcgcagacacccttataccggctatccacaagttcctagccggc
accccctctgctctcacttgtacctcgctggtggatcttgtcggcgaccgccgggcccag
aaccagcccggcacaacctccgatatgtatcccaactggtgcatccccctttgcgatggc
aacatccaagccctgaccatcgaggaaatcgccgatctccccttgttccaagcggtagcg
gacgcgtcaaagcggaacaagcgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system