KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1705Help
Entry
Cp267_1705        CDS       T01934                                 

Gene name
yddQ
Definition
Isochorismatase family protein yddQ
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cor00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796864..1797478
Genome map
AA seq 204 aa AA seqDB search
MQRVFSYAFCTILVPSQKENMRALIIVDVQNDFCPGGALETVKGAIQAQSIAEYTASHRG
KYDCIAATKDWHIDPGDHFSQTPDFIDSWPVHCIANTEGADFHPLLSNMHFDEVFYKGHY
SAAYSGFEGSTASGELLGEWLKNRGIREIDIAGIATDYCVQATALDGLREGFRVTVLSHL
CAAVNEDNTHTVLHQLKEHGCVLV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgtattctcatatgcattttgtactatccttgtgccctctcagaaagaaaat
atgcgagccctcatcattgttgacgtccaaaatgacttttgtccgggaggggcgttagaa
acggtcaagggcgcaatccaagcacaatccattgcagaatacacggcgtctcatagggga
aaatacgactgcatcgcagccaccaaagattggcacattgaccccggcgatcatttttct
cagacaccagactttattgactcctggcctgtacattgcatagccaacacggaaggcgcc
gattttcacccattgctctcaaacatgcactttgatgaggttttttataaggggcactat
agtgcggcttactcggggttcgaggggtccacagcatctggagagttattaggtgaatgg
ttaaagaatcgcgggatacgcgagattgatatcgcgggaatcgctacggattattgcgtt
caggctacggctcttgacggtttaagagaaggcttccgtgtgacggtgctctcgcacctt
tgcgccgcagtcaacgaggacaacacccacacagttttgcatcagcttaaagagcatgga
tgtgtccttgtttag

DBGET integrated database retrieval system