KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1800Help
Entry
Cp267_1800        CDS       T01934                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Cp267_1800
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cp267_1800
Enzymes [BR:cor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cp267_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1899585..1900058)
Genome map
AA seq 157 aa AA seqDB search
MTNFFDIPVTLNDATETTMNDWAGHCLMIVNTASRCGLTPQYEALEELYRDYAPRGFFVI
AMPCNQFAEEEPGTNKQIAEFCKREYGVTFFILEKADVNGENTHPLYQFLKGDGPDIEWN
FEKFVVSTEGKVVGRFAPNMEPDDLKIIECLEDNLVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttctttgatattccggtgacgcttaatgacgccaccgagacaaccatgaat
gattgggcagggcattgcctcatgatcgtgaataccgcatctcggtgtggtctgactcct
caatatgaagccctggaggagttgtatcgggattatgcgccacgcggattttttgtgatt
gcgatgccatgcaaccagtttgctgaggaagagcctggaaccaataaacagatagcagag
ttctgcaagcgggaatatggcgtgactttctttattcttgaaaaggcagacgttaacggg
gagaacacacatccgctgtaccaattcttaaaaggagatggccccgatatcgagtggaac
tttgaaaagtttgtggtctcgactgaaggaaaggtcgtggggcggttcgctccgaatatg
gagccggatgatttgaagatcatcgagtgcttggaagacaacttggtgctttag

DBGET integrated database retrieval system