KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1858Help
Entry
Cp267_1858        CDS       T01934                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cor00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1961172..1961627)
Genome map
AA seq 151 aa AA seqDB search
MKAVLSIGSNMDDRYALLRSAYEEFLPDLVAASSIYATPPWGVEDQDEFLNAVLIVDVDE
TPMELLKRGQALEQAAERKRIRRWGPRTLDVDIVCIEGVTSDDPVLTLPHPYAHERNFVL
VPWLEADPDATLDGRPLSELITGTFPIVGTL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagttttatccatcgggtctaatatggatgaccgctatgctttgctgaggtca
gcgtatgaggaattcctgcctgatctggttgccgcatccagcatctatgccaccccaccg
tggggcgtagaagaccaggatgagttccttaacgcggtgctcatcgtagacgtggatgag
accccgatggagctgcttaaacgcggtcaagccctagaacaggccgcggagcgcaagcgg
attcgacgctgggggccccggacactcgacgtagatattgtgtgcatcgagggcgttaca
tcggatgatcccgtgctcacattgccgcacccttatgcccacgagcgtaattttgtgctg
gtgccgtggcttgaggcggaccctgatgcgacgctcgatggacgcccattatcggagctg
atcacgggaacttttccgattgtggggaccttatga

DBGET integrated database retrieval system