KEGG   Corynebacterium pseudotuberculosis 267: Cp267_2139Help
Entry
Cp267_2139        CDS       T01934                                 

Gene name
nanK
Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
cor00010  Glycolysis / Gluconeogenesis
cor00052  Galactose metabolism
cor00500  Starch and sucrose metabolism
cor00520  Amino sugar and nucleotide sugar metabolism
cor00521  Streptomycin biosynthesis
cor01100  Metabolic pathways
cor01110  Biosynthesis of secondary metabolites
cor01120  Microbial metabolism in diverse environments
cor01130  Biosynthesis of antibiotics
cor01200  Carbon metabolism
Module
cor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp267_2139 (nanK)
   00052 Galactose metabolism
    Cp267_2139 (nanK)
   00500 Starch and sucrose metabolism
    Cp267_2139 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp267_2139 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp267_2139 (nanK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp267_2139 (nanK)
Enzymes [BR:cor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp267_2139 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Acetate_kinase DUF320
Motif
Other DBs
NCBI-ProteinID: AFH53009
Position
complement(2284316..2285230)
Genome map
AA seq 304 aa AA seqDB search
MIGAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLVDSYNAYAEHPAVDLHEIMARYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcaggcaataaagtgcaaacccccgtacgcattggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacgcccgcgagcaatgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctaccgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatccgct
gccctcttagagtccttcgcctctggtcctggactcgttgactcctataacgcgtatgcg
gagcacccagccgtggatctccacgagattatggctcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcgtgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtaggagccgcatatctgggg
aagacccaagactaa

DBGET integrated database retrieval system