KEGG   Corynebacterium pseudotuberculosis 267: Cp267_2139Help
Entry
Cp267_2139        CDS       T01934                                 

Gene name
nanK
Definition
N-acetylglucosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp267_2139 (nanK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp267_2139 (nanK)
   00052 Galactose metabolism
    Cp267_2139 (nanK)
   00500 Starch and sucrose metabolism
    Cp267_2139 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp267_2139 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp267_2139 (nanK)
   00524 Butirosin and neomycin biosynthesis
    Cp267_2139 (nanK)
Enzymes [BR:cor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp267_2139 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2284316..2285230)
Genome map
AA seq 304 aa AA seqDB search
MIGAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLVDSYNAYAEHPAVDLHEIMARYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcaggcaataaagtgcaaacccccgtacgcattggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacgcccgcgagcaatgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctaccgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatccgct
gccctcttagagtccttcgcctctggtcctggactcgttgactcctataacgcgtatgcg
gagcacccagccgtggatctccacgagattatggctcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcgtgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtaggagccgcatatctgggg
aagacccaagactaa

DBGET integrated database retrieval system