KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_0144Help
Entry
Cp4202_0144       CDS       T02053                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cos03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150545..151201
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDALGAVRDGVTFCRICC
NISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgcttcaggaccttattgatgagctttcacggctccccggcgtgggc
cctaaatctgctcaacgcatcgcttttcacttgcttcatgtggagcctgcggacatcgca
agacttcaggatgccctcggtgctgtccgagatggcgtgaccttttgtcgtatttgctgc
aatatctcccgcgaatcggtatgccgtatttgtgcggattctggccgggatcggggaacg
atctgcgtggtggaggaacccaaagatattcaggttattgagcggacgggcgaatataat
ggccgctaccatgtgctgggtggggcgttggatccgctagctaatattggtccccgtgaa
ctgaatatttctacgttgctgcagcgcattggaggggtgcttcctgatcgagagctagcg
gattctacgcctgatgcgccgctgtatgattcctctccgacggtgacagaggttattctt
gccaccgaccccaataccgagggtgaggcgacggcttcttatcttgcacgtctgctccga
gattttcctgatttggtggtttctcgtctggcttccggtatgcctttgggcggggaccta
gaatttgtggatgaactgacattgtcccgcgccctgagcggtcgattgacaatttaa

DBGET integrated database retrieval system