KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_0605Help
Entry
Cp4202_0605       CDS       T02053                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase echA6
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00071  Fatty acid degradation
cos00280  Valine, leucine and isoleucine degradation
cos00310  Lysine degradation
cos00360  Phenylalanine metabolism
cos00380  Tryptophan metabolism
cos00410  beta-Alanine metabolism
cos00627  Aminobenzoate degradation
cos00640  Propanoate metabolism
cos00650  Butanoate metabolism
cos00903  Limonene and pinene degradation
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01130  Biosynthesis of antibiotics
cos01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp4202_0605 (echA6)
   00650 Butanoate metabolism
    Cp4202_0605 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp4202_0605 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp4202_0605 (echA6)
   00310 Lysine degradation
    Cp4202_0605 (echA6)
   00360 Phenylalanine metabolism
    Cp4202_0605 (echA6)
   00380 Tryptophan metabolism
    Cp4202_0605 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp4202_0605 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp4202_0605 (echA6)
   00281 Geraniol degradation
    Cp4202_0605 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp4202_0605 (echA6)
   00627 Aminobenzoate degradation
    Cp4202_0605 (echA6)
   00930 Caprolactam degradation
    Cp4202_0605 (echA6)
Enzymes [BR:cos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp4202_0605 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEP69869
Position
647270..647956
Genome map
AA seq 228 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALSSGFVAIRGDHAAAVAFAHEVAGLASLSVR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggtgctgggatgcagcttgct
ttggcgtgtgatctccgtgttgttggagagtctgcatggtttaaagtccccgctgtttct
ttggggtttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcattgaccccggatgcggctctgtctagt
ggttttgttgcaatccggggcgaccatgctgcagcagttgcttttgctcatgaagttgcc
ggattggcgtctctttctgtacggtag

DBGET integrated database retrieval system