KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_0676Help
Entry
Cp4202_0676       CDS       T02053                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cos00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722381..723340
Genome map
AA seq 319 aa AA seqDB search
MIEENPELKHGKRITATAHSKVNLHLGVGPRRHDGYHELVTIFQSLSLKDEVECVELRGT
ATDQKSGIVAELDAYEADGVPTDNSNLAWKAADMVYAFHRSGGGPPLNKVRICLKKGIPT
AGGMAGGSADAAAALRLMQEYVTVKPTDKQLLTMASALGSDVPFTLLGGTRLGTGRGENL
VHVMSRGQYHWALAFSTQGLSTPAVFAKLDQMQRTPHLSVDDLTAALISGDPYHVAQYLH
NDMQPAALSLQPGLRKTLEVGKASGALAGIISGSGPTCAFLCPDAESAEDVAAELRLIGP
AATATGPALGATISTTTRS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggagaatccggagcttaagcacggcaaacgcatcacagcaaccgcgcattca
aaagtgaacctccaccttggagtgggcccgcggcgccacgacggctatcacgagcttgtc
actatttttcaatctttgagccttaaagatgaagtggaatgcgtagagctacgcggaact
gcaaccgatcaaaaatccggaatcgtagctgagcttgacgcctatgaggctgacggagtt
cctaccgataacagcaatcttgcgtggaaagccgccgatatggtctatgcttttcatcgt
tctgggggcggacctcccctgaacaaagtacggatctgcttaaaaaagggaattcctaca
gccggcggcatggcaggaggctcagcagacgctgctgcggcgcttcggcttatgcaggaa
tacgtcacagtaaaaccaactgataagcagctactcactatggccagtgccttaggatcg
gacgttcctttcacgcttttaggcggcacgcggctgggaaccgggcgtggagaaaacctc
gttcacgttatgtcccgaggccaatatcattgggcgttagctttttctacacaaggtctt
agcactcctgcggtctttgccaagctagatcagatgcaacgcaccccgcacttatccgta
gatgatctgacagcagcgctgattagcggagacccgtaccacgtagctcagtatcttcac
aacgatatgcaacctgcagctctttcccttcagccaggtttgagaaaaactctggaggtg
ggtaaggcctcaggtgcgctggcagggattatttctggctccggccccacctgcgctttt
ctttgcccggatgcggaaagcgccgaggacgtagccgcagagctgcggcttataggacca
gctgcaaccgcaacaggtccagcgctaggcgctaccatttccaccacaaccagatcatag

DBGET integrated database retrieval system