KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_0771Help
Entry
Cp4202_0771       CDS       T02053                                 

Gene name
folP
Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cos00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826538..827395
Genome map
AA seq 285 aa AA seqDB search
MPRSAFLGTEGLATVMAIVNRTPDSFYDHGATHAFDAAIKRAGAVIAAGAGIVDIGGVKA
GPGEFVSISEEIDRVVPVIAAVHEAFPETIISVDTWRAKVAELAVDAGAALINDTWAGYD
PELVEVAGDRRVGYICSHTGGVVPRTRPYRVHYDDVVHAVIDETTRQAEHAVSLGVPEDK
IFIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFIGETLARNVDKRVPGTLA
ATAWSAERGVAAFRSHQVEETIDVIRMTAAIQGTVSPLKTTRGLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggagcgccttcctaggcactgaaggcttagctacggtgatggcgatcgtaaat
aggacgcccgattccttttacgatcatggtgcaactcatgcttttgatgccgcaatcaag
cgtgcaggagcagtgattgcagccggtgccgggatcgtggatatcggtggggtcaaagcc
gggccaggtgagtttgtttccatttctgaagaaatagaccgtgtggtgccggtgatcgct
gcggtgcacgaggctttccccgagacaatcatttcggtggatacctggcgcgcaaaagtc
gccgagttagccgtcgacgcaggcgccgcgctcatcaacgacacctgggccggttacgat
ccagaactcgtagaagtcgctggagatcgtcgagttggatatatctgctcacacaccggc
ggcgtggtccctaggacaaggccgtatcgcgtgcattacgacgacgtggtgcatgcggtt
atcgatgaaaccacgcggcaagcggagcacgcagtgtccctaggagtaccagaagacaag
atattcatcgaccccactcatgactttggcaaaaacaccttccacgggcttgagcttcta
cgacgaatcgacgaaatcgtggccaccggatggcctgttctcatggctctgtccaataag
gattttattggagaaacgcttgctcggaacgtcgataagcgagtgcctggcactttggcg
gcaacagcatggtctgcggagcgaggcgtggcggcgtttcgttcgcatcaagtggaagaa
acaattgacgtgattcggatgactgcggcgattcaaggaacggtttctccgctgaaaaca
actagaggtttggcgtga

DBGET integrated database retrieval system