KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1096Help
Entry
Cp4202_1096       CDS       T02053                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00010  Glycolysis / Gluconeogenesis
cos00051  Fructose and mannose metabolism
cos00562  Inositol phosphate metabolism
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01130  Biosynthesis of antibiotics
cos01200  Carbon metabolism
cos01230  Biosynthesis of amino acids
Module
cos_M00002  Glycolysis, core module involving three-carbon compounds
cos_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp4202_1096 (tpiA)
   00051 Fructose and mannose metabolism
    Cp4202_1096 (tpiA)
   00562 Inositol phosphate metabolism
    Cp4202_1096 (tpiA)
Enzymes [BR:cos01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cp4202_1096 (tpiA)
Exosome [BR:cos04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cp4202_1096 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cp4202_1096 (tpiA)
  Exosomal proteins of melanoma cells
   Cp4202_1096 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEP70352
Position
complement(1207707..1208486)
Genome map
AA seq 259 aa AA seqDB search
MERKPLIAGNWKMNLDHMQAVATVQKLAFALPAEYYEKVDVAVTVPFTDLRSVQTVIDGD
KLQITYGAQDVSEHESGAYTGEISAAMLAKLGCTWVVVGHSERREYHDESSKLVAAKAKA
ALSKDISPIVCVGEPLTIREAGTHVDFVVEQTRESLAGLTEDELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIKELANEKIAAGIRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagccgctcatcgccggtaactggaagatgaatttagaccacatgcaagct
gtggcaacggttcagaagttagcgtttgcacttcctgccgaatactacgagaaagtggat
gtcgcagttactgtaccgttcacagatctacggtctgtccagactgtgattgatggagat
aaacttcagatcacgtacggcgcccaagatgtatcagagcatgaatcgggcgcttacact
ggagaaatctctgcagctatgcttgcaaagcttggctgtacatgggttgtggtggggcac
tcggagcgccgtgagtaccatgatgaatcttcgaaacttgttgcggcgaaggctaaagca
gcactgagcaaagatataagccctatcgtttgcgtcggtgagcccctaacgatccgggaa
gcaggaactcacgtagatttcgtcgtggagcaaacccgtgagtcgcttgcaggcctgacc
gaagacgagcttgctaagaccgttatcgcttatgagccggtttgggcaatcggtaccggg
aaggttgcttctgctgctgatgcccaagaggtgtgtaaagcaatccgcggtttgattaaa
gaacttgccaacgagaaaatcgccgcaggaattcgtatcctgtatggcggttctgtaaaa
gaagagacagtagcagagatcgtcggacaacccgatgtagatggtgggcttgtcggcggt
gcttctcttgatggcgaggcatttgccaagcttgcagctaatgcagctaccggtctttaa

DBGET integrated database retrieval system