KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1196Help
Entry
Cp4202_1196       CDS       T02053                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00010  Glycolysis / Gluconeogenesis
cos00520  Amino sugar and nucleotide sugar metabolism
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01130  Biosynthesis of antibiotics
cos01200  Carbon metabolism
Module
cos_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp4202_1196 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp4202_1196 (ppgK)
Enzymes [BR:cos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cp4202_1196 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEP70451
Position
1319324..1320100
Genome map
AA seq 258 aa AA seqDB search
MPFSKLKFMTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRI
VAEAEWEGPVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAA
GIAEVAFGEDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAA
KDRDELSYSKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLR
NTAGIVGAAMAADQNIRP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgccattcagtaagctcaagttcatgacacgaattggctttggcattgatgttggcgga
tctgggattaaaggtgcccgcgttgatctggataccggtgattttgtcggagatcggatc
aaaattttaacccccaagcctgccacccccgaagcggtcgcccaaacgatttctcgcatt
gttgcagaggccgaatgggaaggacccgtcggaataacgctgccttccgtaatccggaat
caagtagcactttctgccgccaacattgaccaatcatggatcaatgttgatgttcaaaaa
ttatttaccaagaccctgggcgggcgtaacatcgcagtgcttaacgacgccgatgcggcg
ggcatcgccgaggtagccttcggagaagatcaagctcgacgtggttccgccattttgctc
actctaggcactgggatcggttccgctttctttatcaacggggtcttattccccaacacc
gagttagggcacatgatcgtagagggaaaggaagccgagcatctagcttcatctgcagca
aaagatcgcgatgagttgagctattccaaatgggccaagcgcgtttctaaagtcctcagc
gaatacgaacgacttttttggccagacgtttttatcgtaggcggtggtatctcacgcaaa
gctgataaatgggtacccaaactcactatcgatacgcccgtcatacctgcaaaactacgt
aataccgcaggtatcgtaggagcagcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system