KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1468Help
Entry
Cp4202_1468       CDS       T02053                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00260  Glycine, serine and threonine metabolism
cos00750  Vitamin B6 metabolism
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01230  Biosynthesis of amino acids
Module
cos_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp4202_1468 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cp4202_1468 (thrC)
Enzymes [BR:cos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cp4202_1468 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEP70713
Position
complement(1620434..1621876)
Genome map
AA seq 480 aa AA seqDB search
MHYISTRDTSQTPVAFTDILLGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALA
AEVLKLFVDDIPAEDLEAITARAYTTPKFSDEEIVPVTKLEDGIYIGHLSEGPTAAFKDM
AMQLLGELFEYELLRRKETLNILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQ
AQMFGLDDPNIFNIALEGVFDDCQDVVKAVSSDAEFKADNHIGAVNSINWARLMAQVVYY
ISLWLKVTEKSNQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
EYRVRSAAETLETSSPSMDISRASNFERFIFDLLGRDSERCAELFGEQVKAGGFSLAEDD
SFEQAATHYGFASGSSTHADRIATIADCYTRRGLMLDPHTADGVKVAREWATQIESPIVC
LETALPVKFTDTIVEAVGRGPEIPERFTGILEAQRHVTDLPNDVVAVKNFILESIARDSA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcactacatttcgacaagagacacttcccagacccctgtagcgtttactgacatcctc
ttgggaggtctcgctccagatggtggtttgtatcttcctgagtattacccgcgtctcgac
gctgccaccctagacacctggcgcggcattcttgcccagcaaggctatgcggcgctagca
gcagaagtgcttaagctctttgtcgacgacatcccggctgaggatctagaagctattact
gcgcgcgcttatacaacgcctaagttttccgatgaggaaatcgttccggtgaccaagctt
gaggatggcatctatataggtcacctctctgaggggcccactgctgcatttaaagatatg
gccatgcagctccttggcgagctctttgagtatgagttgctacgacgcaaggaaacttta
aacatcctgggtgctacctctggcgacacaggttcttctgcggaatacgctatgcgcgga
cgcgccggtatccgagtgttcatgcttacccctaaagatcgtatgacgccgtttcagcag
gcccagatgtttggtctagacgatccgaatatcttcaatattgccttagagggtgttttt
gatgactgccaagacgtggtcaaagcggtatcttcagacgcagaatttaaagcagacaac
catatcggcgcggtgaactcaattaactgggctcgcttgatggctcaagtggtgtactac
atttctttgtggctcaaagtaactgagaaaagcaatcaaaaagttagtttctgtgttccc
accggcaattttggtgatatctgcgcagggcatatagctaaacaaatgggattgcccatt
gacaggctcatcgttgctaccaatgaaaacgatgtcctggatgagtttttcagaactggt
gaatatcgtgtgcgttctgcggctgagacccttgagacctcctcgccctcgatggatatt
tctcgggcatccaactttgagcgttttatttttgacctattaggaagagactccgagcgc
tgcgcagaactattcggggagcaagtaaaggccggcggtttctctctcgcagaggacgat
tcatttgaacaagctgccacccattatggttttgcgtcgggcagctctactcacgcagac
cgcatagccaccattgccgattgttatacgcgccggggcctgatgttggaccctcatacc
gctgatggtgtgaaagttgcgcgcgagtgggccactcagattgaaagccctattgtctgc
ttggaaaccgccctgccagttaaatttacggatactatcgttgaggccgtggggcgtggt
cctgagataccagagcgttttactgggattctcgaggcacaacgccatgtcaccgatctg
cctaatgacgttgttgcggtgaagaactttattctggaaagcattgctcgggactctgcg
taa

DBGET integrated database retrieval system