KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1884Help
Entry
Cp4202_1884       CDS       T02053                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00010  Glycolysis / Gluconeogenesis
cos00071  Fatty acid degradation
cos00350  Tyrosine metabolism
cos00625  Chloroalkane and chloroalkene degradation
cos00626  Naphthalene degradation
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01130  Biosynthesis of antibiotics
cos01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp4202_1884 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp4202_1884 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cp4202_1884 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cp4202_1884 (adhA)
   00626 Naphthalene degradation
    Cp4202_1884 (adhA)
Enzymes [BR:cos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cp4202_1884 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short TrkA_N Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AEP71117
Position
complement(2073613..2074770)
Genome map
AA seq 385 aa AA seqDB search
MVVSPAGVMPVGVQSFRGLNEYRSQQGVGIDNAYEKGKIDVKTDFPEAFTAAVVDNFGPE
LNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVKPEPPFVPGHEGVGEVVKLGP
GHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYGGYTVDGSFGEYMLVDTRYCA
RIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISGIGGLGHIAVQYAVAMGMRVI
AVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGAHGVLVTAVHPQAFGQAIGMA
RKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQDLEEALDFYARGMIKPTVTEC
KLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgtccccagccggcgtcatgccggttggggttcagtcgtttaggggacttaat
gaataccgttcccaacaaggtgtaggtattgacaatgcctacgagaaaggaaagatcgac
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system