KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1984Help
Entry
Cp4202_1984       CDS       T02053                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp4202_1984 (deoA)
Enzymes [BR:cos01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp4202_1984 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2203003..2204358
Genome map
AA seq 451 aa AA seqDB search
MGTLAELPYSTSQALTAPMEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIV
GDDQMAALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITL
PLAPLVASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAA
GAGLAPADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQ
ARELARTMVDLGRDARTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTC
ALATEMLELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDG
YLTEMDALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDR
FSRALESLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgggtactctggccgagttgccatatagcacttcccaagccttaacagctccaatggaa
ggtgataccgtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgggacaac
gggaagctaagcaagggacaaatcgactggatcatcgatgcctacactcgcggcattgtt
ggcgacgatcaaatggctgccctcaacatggcaatattcctcaacggcatggacagagaa
gaaatcgtccagtggacccaggccatgatcgactccggcgagaccatgagctttgccagc
ctctcccggccaacaacagacaagcactccaccggcggggtcggcgataaaatcacgctt
ccacttgcgccactcgttgccagttacggcgttgctgtgccacaactctctggtagagga
ctaggacacacaggcggaaccctagacaaattagaggccatccccgggtgggaagctgac
atagataatgcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgcgccgcg
ggagcaggcctcgcacccgccgacaagaagatctatgcgctgcgtgacatcactgccacc
gtcgactgcatcccactgatcgccagctccatcatgagtaaaaaaatcgccgagggaacc
gcaaacctagtcctcgacgtcaaggtgggttccggggcctttatgaaggagcttgaccag
gcccgcgagctcgcccgcacaatggttgacctaggccgcgacgccagaaccaatatggtc
gcgcttctcaccgacatgtccgtccccctggggcgcaccatcggcaatgccctagaagtt
cgcgagtctgtagaggtcctcgcaggtggcggcccttccgacgtcatagagctcacatgc
gcccttgcgacggagatgcttgagctcgccggcgtccatgatcccgatgtccacgaagcg
cttgccgacggccgcgcgatggactcttggaagaagatgatccgcgcacagggcggcgac
cccgacgcagcactccccaccgcacggcacacccatgaggtcaccgccgatcgcgacggc
tatctcacagagatggacgccctcgcactgggagtagccagctggcgactcggcgcagga
cgcgcacgcaaggaagatccagtccaactcggcgcaggcatcgagatccatgcagagctc
ggcgagaaggtatcaaagggccagaagcttttcaccctccacaccgacgatgaggaccgt
ttcagccgagccctagaatccctcgaacccggcgtaaatatcggcgatgagcccccggca
cctcgcccctcggtcatccttgatcgcatcagctaa

DBGET integrated database retrieval system