KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_2054Help
Entry
Cp4202_2054       CDS       T02053                                 

Gene name
nanK
Definition
N-acetylglucosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cos01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cos00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cos00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cos00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cos00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cos00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2284139..2285053)
Genome map
AA seq 304 aa AA seqDB search
MIGAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLVDSYNAYAEHPAVDLHEIMARYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcaggcaataaagtgcaaacccccgtacgcattggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacgcccgcgagcaatgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctaccgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatccgct
gccctcttagagtccttcgcctctggtcctggactcgttgactcctataacgcgtatgcg
gagcacccagccgtggatctccacgagattatggctcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcgtgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtaggagccgcatatctgggg
aagacccaagactaa

DBGET integrated database retrieval system