KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_2054Help
Entry
Cp4202_2054       CDS       T02053                                 

Gene name
nanK
Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00010  Glycolysis / Gluconeogenesis
cos00052  Galactose metabolism
cos00500  Starch and sucrose metabolism
cos00520  Amino sugar and nucleotide sugar metabolism
cos00521  Streptomycin biosynthesis
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01130  Biosynthesis of antibiotics
cos01200  Carbon metabolism
Module
cos_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp4202_2054 (nanK)
   00052 Galactose metabolism
    Cp4202_2054 (nanK)
   00500 Starch and sucrose metabolism
    Cp4202_2054 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp4202_2054 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp4202_2054 (nanK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp4202_2054 (nanK)
Enzymes [BR:cos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp4202_2054 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Acetate_kinase DUF320
Motif
Other DBs
NCBI-ProteinID: AEP71281
Position
complement(2284139..2285053)
Genome map
AA seq 304 aa AA seqDB search
MIGAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLVDSYNAYAEHPAVDLHEIMARYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcaggcaataaagtgcaaacccccgtacgcattggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacgcccgcgagcaatgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctaccgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatccgct
gccctcttagagtccttcgcctctggtcctggactcgttgactcctataacgcgtatgcg
gagcacccagccgtggatctccacgagattatggctcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcgtgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtaggagccgcatatctgggg
aagacccaagactaa

DBGET integrated database retrieval system