KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_2064Help
Entry
Cp4202_2064       CDS       T02053                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cos00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2295222..2295740)
Genome map
AA seq 172 aa AA seqDB search
MPIIAPWFGKLMGHKELQHGWARRQKWEVLETSGGLDARMSHDDWDLRLAVQSTPRGFAM
MLKCRNASSVCRKLQLAFHPYFYVSDVLDTIVTAPGETFTTDGGLLEEFRLSAPTPLLID
DGQRLITVKGQGTDHFIVWNPGEKLASEMSDMGTGEWRNFVCVEPALLGEDS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgcccattattgctccgtggtttggcaaacttatggggcacaaggagctgcaacatgga
tgggcgcgccggcagaaatgggaggtgctagagacctcgggtgggctcgacgctcgaatg
agtcatgatgattgggacttgcgtttggcagtccagtcgacgccgcgaggttttgccatg
atgctgaaatgtagaaacgcctcaagcgtttgccggaagcttcagttggcgttccatcca
tatttttatgtctctgacgttcttgataccatcgtgaccgcccccggtgagacctttact
acggacggtggtttgttggaggaatttcgcctctccgctcccacgcctctgcttatcgat
gacggccagcgtctcatcaccgttaaagggcaagggactgatcactttattgtgtggaac
cctggcgagaaactggcgagtgagatgtccgatatgggcactggggaatggcgaaacttt
gtctgtgtagagcccgctctcctaggggaagactcctaa

DBGET integrated database retrieval system