KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_2077Help
Entry
Cp4202_2077       CDS       T02053                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cos01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cos00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2310079..2311344
Genome map
AA seq 421 aa AA seqDB search
MECKSASPSLGTIRTDYSPGDIARIYSRYASAISVLCEPDKFNGDYDHLATVAASTHLPV
LCKDFIVDPVQVQAARYFGADAVLLMLSVLDDATYLSLSSEAERLGLDVLTEVINEEEVK
RGIRLGAKIFGVNHRNLHDLSIDLSRSSQLEPLIPENAVLVSESGIKTNETVRQLAGHSD
AFLVGSQLTSHSNIDSASRSLVYGTNKVCGLTTASAAQNARAVGATHGGLIFEDSSPRNV
SRETAEKIIAAEPNLNYVAVSRRDHGWEEILLPEITSLQIHAPYQGSIAGERALIDNARR
ELQKAGREDVSIWRAVSMTLPEGAATATALTDDVDMLLLDAGIGGTGTSFNWEKITPDIA
PKAILAGGLNLDNLPEALKAGCAGLDLNSGFEYPSTAGSWSGMKDSGLLRQAFSKIRNFH
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcaaatctgcatcaccatcattaggcacaatccgtaccgactattccccggga
gatattgcacgcatttattctcgatatgcttctgcaatttccgttctttgtgaacccgac
aagttcaacggcgactacgaccacttggccactgtcgcggcttccacgcatttgccggtc
ttatgcaaggactttatcgtcgaccctgtgcaggttcaggctgctcgttactttggcgcg
gacgcggtcttgctcatgcttagcgtgcttgacgacgccacctacctctcactttctagc
gaagccgaacgtctcggactcgatgtgctcaccgaagtaataaacgaagaagaagtaaaa
aggggtattcgtctcggggctaagatatttggcgttaatcaccgcaacctacacgatctc
agcatcgacctttcccgctcctcacagctagagcctctcattccagaaaacgccgtatta
gtatcagaatctggcatcaaaacaaatgagaccgttagacaactagctggacattccgac
gctttccttgtgggctcccagctcaccagccacagcaacattgactccgcctcccgttca
ctcgtttacggaaccaataaggtatgcggtctcaccacggcttccgcagcgcagaatgct
cgcgcagttggcgcaacacacggggggctaatttttgaagactctagcccccgcaatgtt
tcacgtgaaaccgccgaaaaaatcattgcagcggagcccaacctgaactacgttgcagtg
agcagacgcgaccatggatgggaggaaatacttcttccagaaattacgagtctccaaatc
catgccccataccagggatccatagcaggggagagggcgctcatcgataatgcccgtcgg
gagcttcaaaaagcgggaagggaagatgtctccatctggagagctgtgtccatgacactt
ccagagggagccgccaccgctaccgcactgacggatgacgtagatatgttgcttctcgac
gccggcattggaggcaccggaacatcgtttaattgggaaaaaatcacgccagatatagcc
cctaaagcgatcctggcaggaggtcttaacctcgacaatcttcctgaagctttaaaggca
ggatgtgccggcctggatctcaattctggtttcgagtacccatccaccgctgggtcatgg
tctgggatgaaagattccggattgctacggcaagcgttctccaagatccggaattttcat
tattag

DBGET integrated database retrieval system