KEGG   Candida orthopsilosis: CORT_0A00210Help
Entry
CORT_0A00210      CDS       T02488                                 

Definition
Mkc1 MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cot  Candida orthopsilosis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cot00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CORT_0A00210
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CORT_0A00210
Protein kinases [BR:cot01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CORT_0A00210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:20237..21712
Genome map
AA seq 491 aa AA seqDB search
MSQDPVYYGRSVNKVYNQEFIIDRRFKIIKELGHGAYGIVCSAKYDDGTSTDPNANSSSS
ADGSYVAIKKITNIFSKKILCKRALREIKLLQFFRGHKNITCLYDLDIIPNPLTGEFNEI
YLYEELMECDMHQIIRSGQPLTDSHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNAD
CELKICDFGLARGFSENPEQNQGFMTEYVATRWYRAPEIMLSFTNYTKAIDVWSVGCILA
ELLGGKPLFRGKDYVDQLNQILMILGTPPESTLVKIGSQRAQNYVRSLPIMKKISYRHLF
PDANPLALDLLEKMLALDPHERISVNEALEHPYLEVWHDPRDEPECQVKFDFKTFETFEE
LDEMKQLIMDEVRTFRDFVRKPIEEQQQIQLQMQIQQRENQESEEQQRQNRAIDVSSSSN
IREADYPKPQELNDFSFQSLESNNYQYDSRDASMSGINLNDFPNTLGPDYYKLEEELGFG
LDGNAFDNFNQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagatcccgtgtactatggcagatcagtcaataaagtatacaaccaagaattc
attatcgatcgacgattcaaaattatcaaggaattgggtcacggggcatatggtattgtt
tgctcagccaagtatgatgatggcactagtactgaccccaacgccaatctgtcttcttca
gctgatggatcgtatgtagccatcaagaaaatcacaaacatattcagcaaaaagattcta
tgcaaacgggcattgagagagattaaattgttgcagttttttagaggacacaagaatatc
acttgtctttacgacttggacattattcctaacccattgacgggtgaattcaatgagatt
tacctttatgaagagctaatggagtgtgacatgcatcaaattatccgatctggccaacca
ttaactgatctgcactatcaatcgtttatatatcaaatcttgtgtggattaaagtatata
cactcagccgatgtactacatagagatttgaaaccaggtaatctccttgtcaatgctgac
tgtgaattgaaaatttgcgattttggacttgctagagggttttcagaaaatcctgaacaa
aatcaagggttcatgacagaatacgtggcaactagatggtatcgagcaccagaaatcatg
cttagtttcaccaactatacaaaagcaattgatgtatggtctgttggatgtatattggcc
gagttactcggaggcaagcccctcttccgtggtaaagattacgttgatcaattgaatcaa
attttgatgattttgggaacaccaccagagtcaacattggtcaaaattggttcacaaaga
gcacaaaattatgttagatctttaccaattatgaaaaagattagctacagacatcttttc
cccgatgccaacccattggcattagacttgttggagaaaatgttggcattagatccacac
gagcgaattagtgttaatgaagcattggaacatccatacttggaagtatggcatgaccca
agagatgagcctgaatgtcaagtcaaatttgatttcaaaacatttgaaacatttgaagaa
ttagatgaaatgaaacaactaataatggatgaggttagaacatttagagatttcgttaga
aaaccaatagaagaacaacaacaaatacaattacaaatgcaaatccaacaacgggaaaac
caagagctggaagaacaacaaagacaaaatagagctattgatgtcagttcatcatcaaac
attcgtgaagccgattaccctaaaccacaagaattgaatgacttttctttccaaagtctt
gaatcgaacaattatcaatacgattccagagatgctagtatgagtggtataaacttgaat
gatttccccaacacgctaggacctgattattacaagctcgaggaagagctaggatttgga
cttgatggaaacgcatttgataattttaatcaataa

DBGET integrated database retrieval system