KEGG   Candida orthopsilosis: CORT_0A00210Help
Entry
CORT_0A00210      CDS       T02488                                 

Definition
Mkc1 MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cot  Candida orthopsilosis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cot04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:20237..21712
Genome map
AA seq 491 aa AA seqDB search
MSQDPVYYGRSVNKVYNQEFIIDRRFKIIKELGHGAYGIVCSAKYDDGTSTDPNANSSSS
ADGSYVAIKKITNIFSKKILCKRALREIKLLQFFRGHKNITCLYDLDIIPNPLTGEFNEI
YLYEELMECDMHQIIRSGQPLTDSHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNAD
CELKICDFGLARGFSENPEQNQGFMTEYVATRWYRAPEIMLSFTNYTKAIDVWSVGCILA
ELLGGKPLFRGKDYVDQLNQILMILGTPPESTLVKIGSQRAQNYVRSLPIMKKISYRHLF
PDANPLALDLLEKMLALDPHERISVNEALEHPYLEVWHDPRDEPECQVKFDFKTFETFEE
LDEMKQLIMDEVRTFRDFVRKPIEEQQQIQLQMQIQQRENQESEEQQRQNRAIDVSSSSN
IREADYPKPQELNDFSFQSLESNNYQYDSRDASMSGINLNDFPNTLGPDYYKLEEELGFG
LDGNAFDNFNQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagatcccgtgtactatggcagatcagtcaataaagtatacaaccaagaattc
attatcgatcgacgattcaaaattatcaaggaattgggtcacggggcatatggtattgtt
tgctcagccaagtatgatgatggcactagtactgaccccaacgccaatctgtcttcttca
gctgatggatcgtatgtagccatcaagaaaatcacaaacatattcagcaaaaagattcta
tgcaaacgggcattgagagagattaaattgttgcagttttttagaggacacaagaatatc
acttgtctttacgacttggacattattcctaacccattgacgggtgaattcaatgagatt
tacctttatgaagagctaatggagtgtgacatgcatcaaattatccgatctggccaacca
ttaactgatctgcactatcaatcgtttatatatcaaatcttgtgtggattaaagtatata
cactcagccgatgtactacatagagatttgaaaccaggtaatctccttgtcaatgctgac
tgtgaattgaaaatttgcgattttggacttgctagagggttttcagaaaatcctgaacaa
aatcaagggttcatgacagaatacgtggcaactagatggtatcgagcaccagaaatcatg
cttagtttcaccaactatacaaaagcaattgatgtatggtctgttggatgtatattggcc
gagttactcggaggcaagcccctcttccgtggtaaagattacgttgatcaattgaatcaa
attttgatgattttgggaacaccaccagagtcaacattggtcaaaattggttcacaaaga
gcacaaaattatgttagatctttaccaattatgaaaaagattagctacagacatcttttc
cccgatgccaacccattggcattagacttgttggagaaaatgttggcattagatccacac
gagcgaattagtgttaatgaagcattggaacatccatacttggaagtatggcatgaccca
agagatgagcctgaatgtcaagtcaaatttgatttcaaaacatttgaaacatttgaagaa
ttagatgaaatgaaacaactaataatggatgaggttagaacatttagagatttcgttaga
aaaccaatagaagaacaacaacaaatacaattacaaatgcaaatccaacaacgggaaaac
caagagctggaagaacaacaaagacaaaatagagctattgatgtcagttcatcatcaaac
attcgtgaagccgattaccctaaaccacaagaattgaatgacttttctttccaaagtctt
gaatcgaacaattatcaatacgattccagagatgctagtatgagtggtataaacttgaat
gatttccccaacacgctaggacctgattattacaagctcgaggaagagctaggatttgga
cttgatggaaacgcatttgataattttaatcaataa

DBGET integrated database retrieval system