KEGG   Candida orthopsilosis: CORT_0A00760Help
Entry
CORT_0A00760      CDS       T02488                                 

Definition
Hda1 hypothetical proteinistone deacetylase
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CORT_0A00760
Protein phosphatases and associated proteins [BR:cot01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CORT_0A00760
Messenger RNA biogenesis [BR:cot03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CORT_0A00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:168632..171148
Genome map
AA seq 838 aa AA seqDB search
MSDELKKEFASENVKLDPAAEQKMGAKSDDDLNTRQKSDKIEEDSVAVPVKQEDEPEPEA
VIQDEKISNETPIKQEVSEDPTDTEQPPLKKAKLEDDDVEQENGSNGVNGSAAHNELRIV
KSQSRPIVVVPPAKPELFYIPLKTGLVYDVRMRYHAKIFTSYFEYTDPHPEDPRRIYRIY
KKLVEAGLVQDYSLSGIDELGPYMQKIPIREALADEILEVHSEEHLKHIQSTETMTKDEL
LKETANGDSIYVNNDSFFSAKLSCGGAIEACKAVVEGRVKNSLAAVRPPGHHAEPDSPGG
FCLFSNVAVAAKNILKSYPESVRRIVVLDWDIHHGNGTQKAFYDDPRVLYISLHRYENGK
FYPGTKYGGADQVGEGAGEGFNLNIPWRSHGMHDGDYVYAFNKVIIPVMLEYDPDLIIVS
SGFDAADGDVIGACHVSPAGYGYMTHLLKAIARGKLAVILEGGYNLTSISNSALAVAKVL
LGEPPENTIKKQPHGDAIEVIDEVTKIQSKYWKCLKAGVPKTSFDDVYDLPDLDKERYKL
TNISDPIRSYQNNEAYFKKQFINLPIINHDKGDKKNANFTCDLPQQVDELIMASRDIYDC
TSIVFTIHDPPEIWANINPTTGIIESNSSILLEQPLFQIMDKVEKERDSENKDKIGYIDI
NVPSFQLPIPGLSTTYESSYNPTIFAQEVLLYIWDNYISFFTKLKKLVFVGFGDSYQSIV
HLFSKRPSADIKSLVKFTIAYVNRTPLKPINPVMDESMVDWFYHNSTIFTSNLNSCWSNS
GNGSSSDSNGDDLKRPRRKFGRVLKARGDGLFDVINEKFDEGVDNILDSIEDYSSSEE
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgagttgaaaaaagaatttgcgtctgagaacgtgaagttagatcctgctgct
gaacaaaaaatgggtgcaaagtctgatgatgatttaaacactagacagaagctggataag
attgaggaagattctgttgctgttcctgtcaagcaagaggatgaaccagaacctgaagct
gttatacaagatgaaaaaatttcaaatgaaactcccatcaagcaagaagttagcgaagat
ccaaccgatacagagcaacctcctttaaaaaaggctaagcttgaagatgatgatgttgaa
caagaaaatggctccaatggagtcaatgggtctgctgctcacaacgagcttcgcatagtc
aaatctcaactgcgtccaattgttgtcgttccaccagctaaaccagaattgttttacata
ccattgaaaactggattggtatatgatgtgagaatgagataccatgctaagatcttcaca
tcatattttgagtatactgaccctcatcctgaggatcctcgtcgtatatatcgaatttac
aagaaactagtagaagctggtttggtgcaagattattctttatcagggattgatgagttg
ggtccatatatgcaaaaaattcccataagagaagcattagcagatgagatattggaagtt
cattcagaagagcacttgaagcatatacaatccactgaaacaatgactaaggatgaattg
ttgaaggaaacagccaatggcgattccatatatgttaacaatgactccttcttctcggcc
aagttgtcttgtggtggagccattgaggcttgtaaagctgtggtggaaggaagagtcaaa
aactcacttgctgctgttagaccgccggggcaccatgctgagccagattctcctggtggt
ttctgcttgtttagtaatgttgctgttgctgccaagaacattctcaagtcctatcccgaa
tcggtacgaagaatagttgttctcgattgggatattcaccatggtaacggtacccaaaag
gcattttatgacgatccaagagttctatacatttcgctacacaggtatgaaaatggtaaa
ttttatccagggactaaatatggtggagcggatcaagttggtgaaggtgcaggagagggt
ttcaatttgaatattccttggagatcacatggaatgcacgatggtgattacgtgtatgca
tttaataaggtcattattcccgtcatgttggaatacgatccagatttgatcattgtcagc
tctggttttgatgccgctgatggagatgtgattggtgcctgtcatgtgagtccagcagga
tatggatacatgacacacttgttgaaagccatagctagggggaaattggcagtaattctt
gaaggtggttacaatttgacctcaattagtaatagtgctttagcagtggcgaaagtatta
cttggtgagccaccagaaaacaccataaaaaagcagcctcatggtgatgcaattgaggtt
atcgacgaggtcacgaaaatacagtccaaatattggaaatgtttaaaagcaggagtaccc
aagacctcgtttgatgatgtatatgatttacccgatctcgataaagaaaggtacaagttg
accaacatatcagacccaatacgatcttatcaaaacaatgaggcttacttcaaaaagcaa
ttcatcaacttaccaataataaatcacgacaagggagataaaaagaatgccaactttacc
tgtgacttgccccagcaagtagatgagttgatcatggctagtcgagacatctatgattgt
acatcgattgtattcactatacacgacccaccagagatatgggcaaacatcaacccaaca
acaggaatcatagaaagtaactcatctatactattggaacaaccattgtttcaaatcatg
gataaagtggagaaagaaagggatagtgaaaacaaagacaaaattggttacatcgatatc
aatgtcccttctttccagttaccaatccctggattatcaaccacttatgaatcatcatac
aacccaactatttttgctcaagaagtgcttttgtacatttgggataactacatttcattc
tttaccaagttgaagaaattggtatttgttgggtttggagactcatatcaaagtatagtg
cacttatttagtaagcgtccatcagctgatatcaaaagtttggttaaattcaccatcgct
tatgtcaatagaaccccattgaagcctataaacccagtcatggatgaaagtatggttgat
tggttttatcacaattcaacaatctttaccagcaatttaaattcctgttggagtaattct
ggcaatggctcatctagtgattctaatggagatgatttaaagcgaccaagaagaaaattc
ggccgagtattgaaagctaggggagacgggttatttgatgtgatcaatgaaaaattcgat
gagggggtcgacaacattttggatagtatagaggactactcaagttccgaggagtaa

DBGET integrated database retrieval system