KEGG   Candida orthopsilosis: CORT_0A01280Help
Entry
CORT_0A01280      CDS       T02488                                 

Definition
Rpd3 hypothetical proteinistone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CORT_0A01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(278073..279548)
Genome map
AA seq 491 aa AA seqDB search
MYVELPFDELKVSPEKRRIAYFYDQDVGNYFYGTGHCMKPHRIRMTHSLIMNYELYKNME
IYRAEPATNLELTQFHTDEYIDFIDRVTPDNLHLFPREAQIFNVGEDCPVFDGLNEFCKI
SCGGSMEGAARLNNGSADIVINYAGGLHHAKKSEASGFCYTNDIVLAIIELLRKHPRVLY
IDTDVHHGDGVEEAFYTNDRVMTCSFHKFGEFFPGTGNLTDIGIGKGKYHAVNVPLRDGI
DDASYKSIFEPVIKTIVDWYQPSAIVLQCGGDSLSGDRLGPFNLSMRGHANCVNFVRSLG
LPMMVLGGGGYTIRNVARTWAFETGVCNGVILPKELPYNGYYEYYAPTYELDVRSSNMNN
ANSKEYLDRLLTQIVSNLDHTKHAPSVQLQDVPADKEDLGDVDEDMSDAIDTKGGSQKHR
DKEVEKESEFYNDEEKDKGERNVFEQDKIFEADVGKINESKDVEHGVTLFEHEQAEIDQL
NKEGMDVDSGN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttgaactaccgtttgatgagttgaaagtcctgccagaaaagagacgaatagcc
tacttttacgaccaagatgtaggaaattacttttacggaacaggacattgtatgaagccc
catagaatccgaatgacccactcgcttattatgaattatgaattatataaaaacatggag
atatatcgagcagaaccggcaactaatcttgagctcactcaattccatactgatgagtat
atcgactttatcgatcgcgttactcctgataatttacatttatttccccgagaagcccag
attttcaatgtaggagaagattgcccggtatttgatgggttgaatgaattttgcaaaatt
tcgtgtggtgggtcaatggaaggggcagcaaggttgaataacggtagtgctgatatcgtt
ataaactatgccggtggacttcatcatgctaagaaatcagaggctagtgggttttgctat
acgaatgatatcgttttggccatcatagaactacttcgaaaacatccgcgggtattgtat
attgataccgatgtgcatcacggagatggagttgaggaagcattttataccaatgatcgg
gtaatgacttgctcgtttcataaatttggtgaattctttccaggaactggtaatttgacc
gatatcggtattggtaaaggtaaataccatgccgtgaatgtgccattacgagatggtata
gatgatgcttcatacaagtctatctttgagcctgtgataaaaacaattgtcgactggtac
cagccatcagccattgtcctacaatgcggaggtgattctttgagtggtgatcgattagga
ccgttcaacttgtcaatgaggggtcatgcaaattgtgtaaattttgtgagatctcttggc
ttaccaatgatggttctcggtggtggtggttacactattcgtaatgttgcaagaacttgg
gcgtttgagaccggagtgtgtaacggagtcattttgcccaaggaactaccctacaatggg
tactacgaatattacgcgccaacgtacgaacttgacgtgcgttcgtcaaacatgaacaat
gctaactccaaggagtatctagacaggttgctaacgcaaattgtgtccaacttggatcac
acaaaacacgcaccttcagtacagcttcaggatgtgcctgcagataaggaggaccttggt
gatgtagatgaggatatgtcagatgcaatagataccaaaggtggctctcaaaagcataga
gataaggaagttgaaaaggagctggagttctacaacgacgaggagaaggacaaaggtgaa
cgaaacgtttttgagcaagacaaaatttttgaagcagatgttggcaaaataaatgagtca
aaagatgtggaacatggtgtcactttatttgagcatgaacaagcggaaattgatcagttg
aacaaagaaggtatggatgtggatagtggtaactga

DBGET integrated database retrieval system