KEGG   Candida orthopsilosis: CORT_0A02920Help
Entry
CORT_0A02920      CDS       T02488                                 

Definition
Sas3 protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CORT_0A02920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(634875..636890)
Genome map
AA seq 671 aa AA seqDB search
MVSHLLNQLKITNNHVYSNITPNDLEKRSHRLKPASDYSLKRMIQKTREVVQDSPKKKIR
RRVNVNKNEDHYFVTIKYKSKKRELPYKGVLGYPDCIINDTDPTKEERAKFERFRIEGIK
LRNRANSENSQINSGEIPLHTSSEVIKESTPSSVALNKSKIKKIMFRDHEIETWYIAPYP
EEYSQCETLYICEYCLKYMNSPTSYRRHHLKNCNFSNHHPPGTEIYRDSNVSVWEVDGRK
NINYCQNICLLAKLFLNSKTLYYDVEPFVFYVLTERDPNTPSKHHFVGYFSKEKLNNSDY
NVSCILTLPIYQRKGYGNLLIDFSYLLTRNEFKFGTPEKPLSDLGLLSYRNYWKVTIAYK
LRELYQKYRDSGGLNVSLSVLCKMTGMTPANVVVALEQLHALHWKQNGEETKFAIMVNWA
FVDEVIAKWEAKSYAKLDYTKLLWKPMLFGPSGGINSAPALSQGTKQNTPHNSIAQVAAF
LKDDIYNPYSFEEEAWKEVAMCAETSRKRRDFEIEDFLECKPSNTQVKMKPKRRSREDVE
VDLEAVADIFEAEETLKSDVEEESSFEDNDFEVEEDEEEEGSDESLDADESLPVNLLESD
SDSDSYVEDKDRYASRICSKTRSSSVKRRTINVLEGDNRPRGRGRPKGTFKLPRVKQSIP
KPSSKSSRYRK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggtactgcatctactaaatcaactaaaaatcacaaacaatcatgtatactcgaatatc
acaccaaatgatctagagaagcgtagtcaccggttgaagccagctagtgattattcactc
aaaagaatgattcagaaaactcgcgaggtggtacaggattcgccgaagaagaaaatacga
cgaagagtgaatgtaaataagaatgaagatcactattttgtgactatcaaatacaaatcg
aaaaagagagagctaccgtacaagggggtacttgggtaccctgactgtataataaatgac
acagaccctacaaaggaggaaagagcaaagtttgaaaggttccgaatcgagggtataaag
ttacgcaatagagcaaactctgagaactcacaaattaatagtggtgaaatacctctccac
acgtcgagtgaggtgataaaagagtcgactccgtcatccgtcgccttgaataaatcaaaa
atcaaaaaaataatgtttagagatcacgaaatagaaacctggtatattgctccatatcct
gaggaatactcacagtgcgaaaccttgtacatttgtgaatactgcctaaagtacatgaat
tccccgacttcgtacaggcggcatcatttaaaaaactgtaacttctcaaaccatcatcct
cccggcaccgaaatttaccgagattcaaatgtgtctgtatgggaagttgacggacggaag
aatataaattattgtcaaaacatttgtcttttagcaaaattattcttaaactcaaaaacg
ttgtactatgatgtggaaccttttgtcttctacgttttaacagagagggacccaaatacg
ccttcaaaacatcactttgtgggctacttttcaaaggaaaagttgaataacctggactac
aatgtttcatgtatactaacactaccaatataccaaagaaagggatatggaaatttactt
attgacttcagttatttgctaacacggaatgagttcaagtttgggaccccggaaaagcca
ttgagtgatttaggattgttaagttatcgaaattattggaaagtgaccattgcttacaag
ctacgagaactctatcagaaatatcgtgatctgggtggtctcaacgtatcgcttagcgtg
ttgtgtaaaatgactggaatgaccccggccaatgtagttgttgcattagaacaactacac
gctcttcattggaaacaaaatggagaagaaacaaaatttgcgattatggtaaactgggcc
ttcgtagatgaggtcatcgccaaatgggaagcaaaatcgtatgcgaagcttgactatact
aaactattgtggaagccaatgctttttggtccaagtggtggtatcaattctgcgccagca
ctctcgcaaggcacaaaacaaaatactcctcacaatagtatcgcacaggtggccgcgttt
ttaaaagacgatatctataatccatattcttttgaggaagaggcgtggaaggaagttgcg
atgtgtgccgaaacctccagaaagagaagagattttgaaattgaagattttcttgaatgc
aagccatctaacactcaagtcaaaatgaaacctaaaagacgatctagagaggacgttgaa
gtggatttagaggcagttgctgacatttttgaagcggaagaaacattaaaatctgatgtt
gaggaagagtctagttttgaagacaatgatttcgaagtggaggaggatgaagaggaagag
ggaagtgatgagagtctagacgctgatgaatcgttaccggtaaatttgttggagtctgat
tctgactctgattcgtatgttgaagataaagatagatatgcgagtcgaatttgttcaaaa
acaagatcttcttctgtcaagagaaggactattaacgtattggagggagacaataggcct
cgtggtagggggcgtcccaaggggactttcaaattacctagggtaaagcaatctataccg
aagccttcttctaaaagcagtagatatagaaaatga

DBGET integrated database retrieval system