KEGG   Candida orthopsilosis: CORT_0A05660Help
Entry
CORT_0A05660      CDS       T02488                                 

Definition
ubiquitin C-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CORT_0A05660
Peptidases [BR:cot01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CORT_0A05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1250084..1250812)
Genome map
AA seq 242 aa AA seqDB search
MADSKSVIPLESNPSIFTELSYKLGLSPILQFHDVYSLTDPELLSFLPQPIFGIILLFPL
TPNYEAYRKEKDAEAGTYENENPNIHWFKQTIGNGCGLYALLHLLANISTDLTLSHSQIN
DLVTKIQGRNLSVEEISLIVEELEKSIKLDEQFGSKGQTEAPPLGEAVDLHFISFIKGKD
NHLYELDGRRKGPIDLGEVGATGKDSIIKEQKLIEKIQFYIDNADEKNKHNFALMALGPT
LD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagattcgaaactggtgattccattggaatcaaatccttctatttttacagagctt
tcttacaagttgggcctctcgccaatattacaattccatgatgtctactccttaacagac
cctgagctcttgtcatttttaccccagccaatatttggaattatactattgtttcccttg
actccaaactatgaagcctataggaaggagaaagatgcggaagctggtacatacgaaaac
gagaacccgaacatacattggttcaagcaaacgattggaaatggttgcggattgtacgca
ttattacacttgttggcgaatattctgaccgatttgacattaagccatctgcaaataaac
gatttggttaccaagattcagggcagaaacctatctgtggaagaaatcagcttaattgtt
gaagagttggaaaagagcattaaacttgatgagcagtttggctccaaaggacaaacggag
gcacctccattaggtgaagcggttgatcttcattttattagcttcattaaaggtaaggat
aatcacttgtatgaattggacggaaggagaaaaggaccaattgacttgggtgaagttggt
gctactggcaaggacagcattatcaaggaacaaaagttgattgagaagattcaattctac
atcgacaatgcggatgagaaaaacaagcataactttgccttaatggcactaggtccaacg
ttagattag

DBGET integrated database retrieval system