KEGG   Candida orthopsilosis: CORT_0A06260Help
Entry
CORT_0A06260      CDS       T02488                                 

Definition
Ole1 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cot  Candida orthopsilosis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CORT_0A06260
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CORT_0A06260
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CORT_0A06260
Lipid biosynthesis proteins [BR:cot01004]
 Desaturase
  First
   CORT_0A06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1391867..1393330
Genome map
AA seq 487 aa AA seqDB search
MTTTTEQLETVEITKLNAIAAGTNKKVPRIVAAGLGGKLMGTADLVKVTAEEITQDSMES
LAEKDAREKAKYAHKKHISEEPWTTKNFSQKINWLNLILVAGVPAIGMGAALTITPQVKT
LVLAFVLYVFSGISITAGYHRLYAHKSYDAALPVRMFFAFFGAGAIEGSIKWWGHSHRVH
HRYTDTPRDPYDARRGFWYSHMGWMLQKANPKNRARADISDLVADKVVVFQHKHYLLLMV
FSAFILPTLVAGYFWGDYWGGFIYGGVFKSFFIQQATFCVNSLAHWIGTQPFDDRRTPRD
HVLTAFVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKMVIYALSQLGLAWNLKKFSQNAI
EQGLLQQQQKKLDRQRQKLNWGSSVEELPVWTREEFNQRAKKEGLIIISGIIHNVKNFIK
EHPGGQALIRATLGKDATDAFSGAVYRHSNAAHNILATMRVAVVKDVSVNANTFDAQEQY
MEKEKQN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaactacgactgaacaattggagacggttgaaatcaccaaactaaacgccattgcc
gctggtaccaataaaaaggtgcctagaattgtggctgctggattaggtggcaaattaatg
ggtactgccgatttagttaaagttactgctgaagaaatcactcaagattcgatggaatct
ttagctgaaaaagatgctagagaaaaagccaaatatgctcacaagaaacatatttcagaa
gaaccttggactaccaagaatttttctcaaaagattaattggcttaatcttatattagtt
gctggtgttccagcaattggtatgggtgctgccctcacaattaccccccaagttaagacg
ttggtattggcatttgtcttgtatgtatttagtggtatttccatcactgccggctatcat
cgtttatatgctcacaagtcatatgatgctgccttacccgtgagaatgttttttgccttt
ttcggtgctggtgccattgaaggttcaattaagtggtggggacattctcatagagttcat
cataggtataccgatactccaagagatccttatgatgctagaagaggtttctggtattcc
cacatgggatggatgttgcaaaaagctaatcctaaaaacagagctagagctgatatttct
gatttagttgctgataaagttgttgttttccaacacaaacattatttacttttgatggtt
ttttcagcgtttatcttgccaactttagttgctggttatttctggggtgattattggggt
ggattcatctatgggggtgtattcaaatcattctttattcaacaagctaccttctgtgtt
aattcactagctcattggattggtactcaaccatttgatgatagaagaactccaagagat
cacgtgttaaccgcatttgtcactttcggtgaaggatatcacaatttccatcatgaattt
ccaagtgattacagaaacgccttgaaatggtaccaatatgatccaacaaagatggtcatt
tatgcattatcacaattgggcttagcttggaacttgaaaaaattttctcaaaatgcaatt
gaacaaggtcttttacaacaacaacaaaagaagttggatagacaaagacaaaaattgaat
tggggatcaagtgtcgaagaattacctgtatggacaagagaggagttcaaccaacgtgcc
aagaaagaaggtttgattataataagtggtattattcacaatgtcaagaactttatcaag
gaacatcctggtggacaagctctaattagagctactttgggtaaagatgcgaccgatgct
tttagtggtgctgtttatcgtcattcaaatgctgctcataatatcttggctactatgaga
gttgctgttgttaaggatgtttctgtcaatgctaacacttttgatgcccaagaacagtat
atggaaaaggagaaacaaaactga

DBGET integrated database retrieval system