KEGG   Candida orthopsilosis: CORT_0A10510Help
Entry
CORT_0A10510      CDS       T02488                                 

Definition
(RefSeq) Lig4 DNA ligase
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
cot  Candida orthopsilosis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cot00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CORT_0A10510
Enzymes [BR:cot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CORT_0A10510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2296171..2298996)
Genome map
AA seq 941 aa AA seqDB search
MSCLLDNVQPPPPNNIEPTLTLLTNELFDKLDAVKRHNLQEASTITERRAQIINDFISTF
RTHIGNDMLQSANLIFPEKTSRLYVIKEVVLARLIIKMYKISKDTEEYNLLHYWNRQYQK
SKRFAVDERKIRDLPLQSARIIATRRPFVERCKEYNVPQINSILDDLTMAKQSQEHLEIL
QPLFDNLRIEEIRWLIHFILKKPILIHMEKYFFNSWHPDGYRLYSICNNLETTFNLLSDP
NRRLAREYLGIQPRYKFKPQLAVKLNSNYNAVVRKLQKKQPMGPQYEQKFTQLELEDKFY
IEEKMDGDRMLLHKEGNRFKFFSRRLKDYSFLYGESFQFGSLTKYIRDAFANNIDSIVLD
GEMVAYDYKRQAILPFGTLKSSAIQESVRQFTTIDHYEQQTSYPYYLIFDILYLNGRDLS
NYPLFFRKNLLERIIKPVPNRFEVLDARLGSSVVDVEKAVREVVTKRSEGLVLKHTQSRY
VIDGFRNPNWIKVKPDYLEKFGENLDLVVIGKNPGVKNSYMMGLINKQEGSEYYGSYYSF
CMCANGFGIEEFDKIERLTHGRWINTAQKMPPEQLIKFGRKKPDFWIDPKYSLVLEIRAR
SIDVRPEATFAVGTTLHNMHCRRIREDKSIGECISMQEYFELKQNYMQDLNLKPQATTIK
KKELTKLTSFNEPSNLKKVKIESDLFASFEFLILSDKRDPHGEIITIEELKTLVKRFGGH
LINSIDAETYLQIIIITEKSLPTSQRYLSQGLDLVKPSWIFECIKRNHILQLEPCFIFDS
QNWPMYDQRVGTYGDSYTVHLPLDQINAPNLTREEVNEFRQQFEWDGAIKPILYLFAGIT
FHVIGTSLAGQLVKNRIERFSGEVVDDFVNCGYIVVPSYEEEELRQQTIATLKKIYEQIN
RNLRISNGKFRSKIPFSVTENFIHESIRSNSVADPEDYKFY
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtttgctcgacaatgttcaacctccaccaccaaacaacatagaaccaactctc
acacttcttaccaatgaattatttgataaacttgatgcagtgaaacgtcataatttacaa
gaagcttcaaccataactgaacgtagagcacaaattatcaatgatttcatttctactttc
cggactcatattggtaatgatatgcttcagtcagctaatctaatattccctgaaaagacc
agcagattatatgtcataaaagaggtggtattagctcgacttattatcaaaatgtacaag
atctccaaagacactgaagaatataatttacttcattattggaaccgacaatatcaaaaa
tctaaacgatttgcagttgatgaacggaaaattagagatttaccgttgcaatctgcaaga
ataattgctacacggcgaccatttgttgaacgttgtaaagagtataatgttcctcaaatc
aattccatattggatgatttaacaatggctaaacaatcacaagaacatttagaaatttta
caaccattatttgataatttaagaattgaagagattcgttggttgattcactttatattg
aagaaaccaattttgattcatatggagaagtattttttcaatagttggcaccctgatggg
tatagattatacagcatttgtaataatttggaaacgacatttaacttgttgagtgaccca
aacaggagattagctagagaatatttaggaattcaacctagatacaagttcaaaccacaa
ttggcggtgaaattaaattcaaattacaatgctgttgttcgtaaattacaaaagaaacaa
ccaatgggtccacaatatgaacaaaagttcactcagttggaattggaggataagttttac
attgaagaaaagatggatggtgatcgaatgttgttgcataaggagggcaaccgattcaaa
tttttttcaagacgtttaaaagattattcatttttatatggtgaatcgtttcaatttgga
tccttaactaagtatatacgagatgcatttgccaataatattgattcaatcgttcttgat
ggggaaatggtggcttatgactacaaaagacaagcaatattaccatttggtaccttgaaa
tcactggcgattcaagaaagtgtacgtcaatttacaaccattgatcattatgaacagcaa
acaagttatccttactatctaatatttgatatcttgtacttaaatggccgtgatttgagt
aattacccgttattttttcgaaaaaatttattggaacgaatcattaaacctgtgccaaat
agatttgaagttcttgatgctagattaggttccagtgttgtggatgttgaaaaagccgta
cgtgaagttgttactaagcgaagtgaaggtttagtcttaaaacacactcaactgagatat
gtaatcgatgggtttagaaatcccaattggattaaagtgaaaccggattatttagagaag
tttggtgaaaatttagatttagtagttattggcaagaacccgggtgtaaaaaattcgtac
atgatgggattaattaataaacaagaaggtagtgaatactatggatcttattatagtttc
tgcatgtgtgccaatggatttggaattgaagaatttgacaagatcgaacgattaacccat
ggtcgatggatcaatacagcacaaaaaatgccacccgagcagttgataaaatttggtcgc
aaaaagccggatttttggattgatccgaaatactcattagttttagaaattcgagctcga
tcaattgatgtacgaccagaagctacatttgccgtggggacaacattacacaatatgcat
tgtcgtcgtatacgtgaagataaatcaattggtgaatgtatttcaatgcaagaatatttt
gaattaaaacagaattatatgcaagatttaaatttgaaaccacaagctactacaataaag
aagaaagaattgactaaattgacctcgtttaatgaaccactgaatttgaaaaaagttaaa
atagaactggatttatttgcaagttttgagtttttaatcttgagtgataaacgtgatccc
catggggaaattattaccattgaagaattaaaaactttagttaaacggtttggaggtcat
ttaatcaattcaattgatgcagagacttatttacaaattataatcattactgaaaagagc
ctacctacaagccaacgatacctatcccaaggtttagatttagttaaaccatcgtggatt
ttcgaatgtatcaaacgaaaccacattttgcagctagaaccttgtttcatatttgattct
cagaattggccaatgtatgatcaacgagttggcacatatggtgattcgtatacggttcat
ttaccacttgatcaaatcaatgctcccaatttaactcgtgaagaagtgaatgaatttcga
caacaatttgaatgggatggtgcaattaaacccatattgtatttatttgcggggataact
ttccacgtaattggtacatctttagctggtcaattggttaaaaaccgtattgaacgattt
agtggtgaggttgttgatgattttgtaaattgtggatatatcgtggttcctagttatgaa
gaagaagagttacgacaacaaactattgcaacattgaaaaagatttatgagcagattaat
cgaaatctacgaattagtaacggaaaatttagaagtaagattccattctctgtcacggag
aattttattcatgaatctattagatccaatagcgttgctgatcccgaagattacaaattt
tattaa

DBGET integrated database retrieval system