KEGG   Candida orthopsilosis: CORT_0A11180Help
Entry
CORT_0A11180      CDS       T02488                                 

Definition
Hog1 MAP kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cot  Candida orthopsilosis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cot00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CORT_0A11180
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CORT_0A11180
Protein kinases [BR:cot01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CORT_0A11180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2456552..2457748
Genome map
AA seq 398 aa AA seqDB search
MSSDGEFTRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSAVDKLTGQNVAVKKIMKPFST
SVLAKRTYRELKLLKHLRHENLITLDDIFISPLEDIYFVNELQGTDLHRLLTSRPLEKQF
IQYFTYQILRGMKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDIWSVGCILSEMIEGKPLFPGKDHVHQFSIITELLGSPPADV
IDTICSENTLRFVQSLPHRDPIPFSERFASCTHVEPEAIDLLSKMLVFDPKKRISAAEAL
THPYMEPYHDPTDEPVCETKFDWSFNDADLPVDNWRVMMYREILDFHQSIGVGGSGLDYE
QQQVADADGNTEKLEELNRQQQQQQQQQQQQFAQEQQT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagatggagaattcacgagaacccaaatattcggtaccgtatttgaaattacc
aatagatacactgacttgaatcctgttggtatgggtgcctttggtttggtttgttctgcc
gtcgacaaattgacaggtcaaaatgttgccgttaaaaaaatcatgaaacccttttcaact
tcggttttggctaaaagaacttatagggagttgaagttgttgaaacatttaagacatgag
aatttgatcactttggatgatatcttcatttcaccattggaggatatctactttgttaat
gagttgcaaggtacagatttacatcgattgttgacatcaagacctttggaaaaacaattc
atacaatactttacgtatcagatattgagaggaatgaagtatatacattcggctggtgtt
attcatcgcgatttgaaaccttccaatattttgattaatgagaattgtgacttgaaaatt
tgtgatttcggtttagctagaattcaagatccacaaatgactggatatgtttccacaaga
tactatcgtgccccagaaattatgttgacttggcaaaaatacgatactgaagttgatatt
tggtctgttggatgtatattatctgagatgattgaaggaaaacctttattccctggtaaa
gatcatgtacatcaattctccattataacggaattattaggaagtccaccagctgatgtc
attgatactatttgctcagagaatacgttgagattcgtgcaatcattaccacatagagat
cctatccctttcagtgaaagatttgcgtcttgcactcatgttgaacctgaggcaattgat
ttattgtccaagatgttagtatttgaccctaaaaagagaatcagcgctgccgaggccttg
actcatccatacatggagccttatcacgaccctaccgatgaaccagtgtgtgagaccaaa
ttcgattggagtttcaacgatgccgacttgccagttgataactggagagtgatgatgtat
agagagattttagatttccaccaaagcattggtgttggtggaagtgggctcgactatgaa
caacaacaagttgccgacgccgatggaaacacagagaaattggaagagttgaatcgacaa
caacaacaacaacagcagcagcaacagcaacaatttgcacaggaacaacaaacttaa

DBGET integrated database retrieval system