KEGG   Candida orthopsilosis: CORT_0A12660Help
Entry
CORT_0A12660      CDS       T02488                                 

Definition
Sas2 protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CORT_0A12660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2762826..2763851
Genome map
AA seq 341 aa AA seqDB search
MSLTIPPKTQEQKQKTPSAKSTSFYGRLEKPNIEKVTFGKYEIRPWYGNPAYFNPYEGVP
NMLGYDYSNMIAADPMSRKRLKSYSVEECFIDHLFVCEYCFKYSVNENEMLEHWEVCKYH
RENPDVGAMVYYDRKRNHIIREVRGYEDPLFCQNLCLFGKLFLDDKSVYFNIDHFNFYVY
YAKDGERDYVPMGFFSKEMIAYDATTNLACICVFPPFQRRHIGAMLIEFSYAIARLTQES
SGPEIPLSPFGKVSYLNYWSKNLAKELLQRRSRTFTLEELSKATGYRKEDVLYTLEHMEV
LIQEPNGEVTFSNDRFQEWVKSTKFDVIRQQPLLDTKSFYL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaactatcccacctaaaactcaagagcaaaaacagaaaacgccgtctgcaaaa
agtacatccttttatgggcgactagagaaaccaaatattgagaaagttacattcgggaaa
tatgagattcggccctggtatggtaatcccgcttatttcaatccatatgagggtgtaccg
aatatgttgggctatgactattcaaacatgatagcagcagatccaatgtctcggaaacga
ctaaagtcatattccgttgaggaatgttttattgatcatctatttgtctgtgaatactgt
ttcaaatattcagtcaatgaaaatgagatgttggaacactgggaggtttgcaaataccat
agggagaatccggatgttggagcgatggtgtattatgatcgcaagaggaaccatatcatt
cgtgaagttagaggatacgaagatcccctattttgtcaaaacttgtgtcttttcggaaag
ttatttcttgatgataaatcagtatacttcaacattgaccatttcaacttttatgtctat
tacgccaaagatggggaaagggattacgtaccgatggggttcttctcgaaagagatgatt
gcttatgatgccaccaccaatttggcgtgtatttgtgtgtttcctccatttcaacgaaga
cacattggtgctatgctaattgaatttctgtacgctatagcacggttaacacaagaaagc
agcggtcccgaaattccactatcaccatttggtaaggtgagttatttgaactattggtca
aaaaatttagcaaaagagttgttacaaagacggtcaaggactttcactttggaagaattg
tcaaaagctacaggctatcgaaaggaggacgtcttgtacacattggaacatatggaggtt
ttaattcaagaacccaacggtgaggtgactttctccaatgatcgatttcaagaatgggta
aaatcaaccaagttcgatgtcatcaggcaacaaccactactcgatacaaaatccttctat
ttgtaa

DBGET integrated database retrieval system