KEGG   Candida orthopsilosis: CORT_0B00110Help
Entry
CORT_0B00110      CDS       T02488                                 

Definition
Gdb1 glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cot  Candida orthopsilosis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cot00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2344..6903)
Genome map
AA seq 1519 aa AA seqDB search
MTSKILFRLSNLGEPVNNENVNNGVLSLPSNDYPKNYKPGDPIFDLQFQLNAASKVARKG
VFHTNAPPSYKDEFDRYKYYDYSIESSFHQDISFTIPLYKPGAYNYYISYEDENGCDKET
EKFYYNVPPHLAIDGKYVPFNAINVETVISKWIGSYDRWPKLFENIKAKGYNMIHFTPLQ
ERGESDSPYSIYDQLKWDPEIFSDQKKAVEQIHKVLNENGLLSLTDVVWNHTANNSEWLK
DAPDSGYNEYTAPHLIPAIELDGALLEFSKRLVELNLPTTIENESDLGKIMEGIKSQVLD
SLNLWEYYVFNREKTLSDLEEIFNKQKSSIKSIKIPDNVDINDLKSLSQFVLDIANIHSK
TILGHRFENKLDSKKFLAVLFALYDGNTIDAGTIVNKAGEIVDQINEPLYRDYDDDLKTI
QQQIADRIRFLRLADNGPKWGKVTTKLPLTEPYFTRFTDKDGKKQALANNGWIWGGNPLV
DFASDKSKAYLRREVIVWGDCVKLRYGSKYEDSPQLWDRMIEYTREMAKVFTGFRIDNCH
STPLHVGERLLDEARKVNPNLYVIAELFSGSEQMDKIFVERLAINSLIREAMQAWSVGEL
SSLVHKHGGRPIGSLTWLPLSDFSYPAEKEPELRKTKEGYTELDIPQVLTSTAPHAIFMD
CTHDNETPAQKRTVEDTLPNAALVAFCSSAIGSVYGYDECYPHLLNVVSEKRLYDLDDTN
GIVKVKAQLNGIRKQLAEESEDISRDHEMYIHHEGQYITIQRYNARTGKGWFLIARSKFY
ENETEQILSPSILGGTKVKHEFSYTLKKTGDYEKDDKFLRGIPVEVVDIEVPHVEFTNGD
SIIQVNNSFIPGSISVFSTEIPGVDIKLDEYVRQGALEASLGLDLYDLNALLYRSAPEEL
DASGGNESVYNIPSYGDLVYAGLEGWQTALKHVVWSNNLGHQICNHLRDGAWALDYVVQR
LDKYAAKSENLRKFQEWLKDRFDAVKKAPYYLRPHYFCLIVGIAYEAARFRVLRQLSKPI
QQATNFVQSLALTSVQMTGFMNNTSLVPDRSVACLAAGLPHFSNDYMRCWGRDVFISFRG
LLIVPERYEDAKEHILGFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFLQAIQEYVLHVP
NGIKILDAKVSRRFPLDDRYVTFDDPLAFSYETSIKDIIFEILQRHAKGIKYREANAGPN
LDSQMKDEGFNVQVGIDWESGFVHGGSQFNCGTWMDKMGESERAHNKGVPGTPRDGAAVE
LQGLLKSALRWVIELNKQGKFDYTEVEKENGEKIAFKDWEKLLQDNFEKRFFVPENASDD
EKYDVDSSLVNRRGIYKDLYHTGKPYEDYQLRPNFPIAMCVAPELFTPELALTAINNADR
IIRGPVGMRTLDPSDYNYRPYYNNSIDNDDFATSKGRNYHQGPEWVWNYGYFLRAFLYFH
FATNNEGSKARTPSIELFTLLNDRIQYHMQWIKESPWAGLTELTNKDGDLCNDSSPTQAW
SSSCLLDLYYDLWKVEKYQ
NT seq 4560 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaaaatcttgttcaggttatcgaacctcggagagcctgtgaacaacgagaat
gttaacaatggtgtattaagtttaccgtcaaatgattacccaaagaattacaaaccgggg
gaccccatatttgacttgcaattccaattgaatgctgcaagtaaagtggcaagaaaggga
gtcttccatactaatgcaccaccgtcgtacaaagacgagtttgatagatacaaatattat
gattactcaattgaatcttcatttcatcaagacatttcttttaccatcccattgtacaag
ccaggagcttataactactacatttcatacgaagatgagaatggttgtgacaaagagact
gaaaagttttattacaatgttccccctcacttagctatcgatggtaaatatgttccattc
aacgcaattaatgtggagacggtgatttccaagtggattggactgtacgatcgctggcca
aagctttttgaaaacataaaagcaaagggatataacatgatccattttacgccattgcaa
gaacgaggtgaatcagattctccttattcgatttatgatcaattgaagtgggatcccgaa
attttttctgaccaaaagaaagctgttgagcagattcataaagtattgaacgagaatggt
ttgctaagcttgacagatgttgtttggaaccatactgctaacaattctgagtggttgaaa
gatgcaccagattcgggttacaatgaatacactgccccacatttgataccagcaattgaa
ttggatggagcattgttggagtttagcaaaaggttggtagaattgaatttgcccactacc
attgaaaatgaatcagacttgggcaaaattatggagggtatcaagtctcaggttttagat
agtttgaacctttgggagtactacgttttcaacagggagaagacgttgtccgacttggaa
gagatattcaacaaacaaaagtcatccatcaagagcatcaagataccagacaatgttgac
ataaatgatcttaaactgctatcgcaatttgttttagatattgcaaatatacactccaaa
acgatattgggtcacagatttgagaataaattagattccaaaaagtttttagccgttttg
tttgcattgtatgatggtaataccattgacgcaggtaccatcgtcaacaaggctggagag
attgttgatcaaatcaatgagcctttgtatagggattacgacgatgacttgaagacaatt
cagcaacaaatcgctgatagaattagatttttgagattagctgacaatgggcccaaatgg
ggaaaggtcacgacaaagctaccattaacggaaccttactttacgaggtttactgataaa
gatggcaagaagcaagccttggccaataacgggtggatttggggcgggaaccccttagta
gattttgcatccgataaatccaaagcctacttgagaagagaggtaattgtatggggcgat
tgtgtcaagttgagatacggttcaaagtatgaggattctcctcaattgtgggacagaatg
attgagtacaccagagaaatggcgaaggtgtttaccgggttcagaattgacaattgtcat
agtactccattacatgttggggagagattgttggatgaggcaagaaaggtgaacccaaac
ttgtatgtcattgctgaactattctctggatccgagcaaatggataaaatttttgttgag
aggttggcaattaactcgttgataagggaagccatgcaagcttggagtgttggtgagttg
tcatcattggtgcacaaacatggtggaagaccaattggttcgttgacatggttaccatta
agtgacttttcgtacccagcagagaaggagccggaattgcgcaaaacaaaagagggttac
acggagttggatattccgcaagttttaaccagcactgcacctcatgcaatatttatggac
tgtacacatgataatgagacaccggcccaaaaaagaactgttgaagatactttgcccaat
gctgcactcgtggcgttttgctcatcagccattggttccgtatatggctacgatgaatgt
tatcctcacttgctcaatgttgtgagtgaaaagagattgtacgatttagatgatactaat
ggaattgtcaaagtgaaggcacaattgaatggcattcgtaagcaacttgctgaagaaagt
gaagacatttctcgtgaccacgaaatgtatattcatcatgaagggcagtacattactatt
caacgttacaatgcgagaacaggaaagggatggttcctcattgctagaagcaaattctat
gaaaacgaaactgaacagattttgtctccctccattctcggtgggaccaaggttaagcat
gagtttagttacacattgaagaaaacaggtgactacgaaaaggacgacaagtttttgaga
ggaattcctgttgaagtggttgatattgaagtaccacatgttgagttcaccaatggtgac
agcatcattcaggtcaacaatagtttcatacctggttcgatatcagttttctccacagaa
attccaggtgttgatatcaaactagatgagtacgtcaggcaaggtgcgcttgaggcatcc
ttaggcttggacttgtatgacttgaatgctttgctttacagaagtgctccagaggagttg
gatgctagcggaggcaatgaaagcgtttacaatataccgctgtatggagatctagtttat
gctggtcttgaaggttggcagaccgcgttgaagcatgtagtctggtccaataaccttggt
caccagatctgcaaccatttacgtgatggagcttgggcgttggattatgtcgtgcaaagg
ttggacaagtatgcagcaaagtcagaaaatttgcgtaaatttcaagagtggttgaaggac
cgttttgatgcagttaagaaggcaccttattacttgagacctcactatttctgtttgatt
gttggtattgcatatgaagcagctaggttcagagtgttgaggcaactaagcaagccaatt
cagcaagcaactaatttcgtgcaaagtttggcattgacaagtgtgcaaatgacaggattt
atgaacaatacctcccttgtaccagacaggtcggttgcttgtttagcagcaggattgcct
catttcagcaacgactatatgagatgttggggaagagatgtgtttatttcctttagaggc
ctcttgattgtccctgagagatatgaagatgcaaaagagcatatacttggatttgccaag
acattgaagcatgggttgattccgaatctcttggatgcagggagaaaccccaggtacaat
gcaagagatgctgcttggtttttcttacaagcgatccaagaatacgtgcttcatgtgcct
aatggaataaagattttagatgcaaaggttagcagacgattccccttggatgataggtat
gttacttttgacgaccctcttgctttcagctatgagacgtctatcaaggatattattttt
gaaatcctccaacgtcacgcaaagggaataaagtatagagaagcaaatgcaggaccgaat
cttgactcacaaatgaaggacgaaggtttcaatgtgcaggtgggaattgactgggagtct
ggttttgtacacggtggttcacaattcaattgtggtacttggatggacaagatgggtgaa
agtgaacgtgctcacaataagggagtacctggaacaccaagagatggagctgctgttgaa
ttgcaaggtttgctcaagagtgcattgagatgggttattgagttgaacaaacagggcaag
tttgattacactgaggttgaaaaggagaatggagagaagatcgctttcaaagattgggaa
aagttgttgcaagacaattttgagaaacgattctttgtgccagaaaacgcaagtgatgac
gagaaatacgacgttgactcttcattggtaaacagacgtggtatttacaaagacttgtac
catacaggaaaaccctatgaggattaccaattgcgtccaaatttcccaattgcaatgtgt
gtggcaccggaattgttcacaccagagctagcattgactgcaataaacaatgctgataga
atcatcagaggtccagttggtatgagaacattggatccactggattacaactatcgccca
tattacaataactccatcgacaatgatgactttgctacatctaaaggtcgcaactaccat
caaggaccagagtgggtatggaactatgggtactttttgagagcgtttttgtatttccat
tttgccaccaacaatgaaggaagcaaagctcgtacgccatcgatagaattgtttacattg
ctcaatgacaggattcagtaccatatgcaatggattaaggagagtccttgggcaggattg
accgagttgacgaacaaagacggtgatttgtgtaatgattctagtccaactcaagcgtgg
agtagctcgtgcttattagacttgtattacgatttatggaaagtcgagaagtatcaatag

DBGET integrated database retrieval system