KEGG   Candida orthopsilosis: CORT_0B01250Help
Entry
CORT_0B01250      CDS       T02488                                 

Definition
Cek1 protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CORT_0B01250
Protein kinases [BR:cot01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CORT_0B01250
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CORT_0B01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:259165..260313
Genome map
AA seq 382 aa AA seqDB search
MSVEHHPQQHHQAQIQQQMQQQQQQQQSETPQRQVSFNVSDHYQILEIVGEGAYGIVCSA
IHKPSQQKVAIKKIEPFERSMLCLRTLRELKLLKHFNHENIISILAIQRPYDYAHFNEIY
LIQELMETDLHRVIRTQTLTDDHIQYFTYQTLRALKAMHSANVLHRDLKPSNLLLNSNCD
LKICDFGLARSIASSEDNFGFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEML
SGRPLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSLPFCKKIPFAELFKNV
NNAPINPLALDLLEKLLIFNPAKRITMEDALKHPYLQLYHDPNDEPVSEKIPEDFFDFDK
KKDELTTEELKRMLYEEIMKPL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgaacatcatccccaacagcaccatcaagctcaaatccaacagcagatgcaa
caacaacagcagcagcagcaatcagagaccccacagagacaggtatcttttaatgtttct
gaccactatcaaatactagagattgtcggtgagggagcttatggtatagtttgttcagcc
attcataaaccatcgcaacagaaagtagccatcaagaaaatcgaaccatttgaaagatca
atgttgtgtttgcgaacattacgtgagttaaaacttttaaaacatttcaatcatgaaaat
atcatatcgatacttgctatacaacgaccatatgattatgcccattttaatgaaatttac
ttgattcaagaattgatggagactgatttacatcgagtgatacgtacacaaaccttgact
gatgatcatatacagtatttcacgtatcaaaccttacgagctttgaaagccatgcattca
gctaacgtattacatcgagatttaaaaccactgaatttattactaaactctaattgtgat
ttgaaaatttgcgattttggtcttgctagaagtatcgcatcactggaagataattttgga
ttcatgacggaatacgtcgctactcgatggtatagagcccctgaaatcatgttgactttt
caagaatataccacggcaattgatgtttggtcagtagggtgcatattggcagaaatgttg
agtggtagacctttgtttccaggaagagattatcacaatcagttgtggttaattatggaa
gtgttaggtacccccaacatggaagattactataatatcaaatcgaaacgagcaagagag
tatattcgatcattaccattttgtaaaaagattccatttgctgaattgttcaaaaatgtt
aataatgcacctataaatccactagcgttggatttattggaaaaattacttatatttaat
cctgctaaacgtatcaccatggaagacgctttgaaacacccatatttacagttatatcat
gatccaaatgatgaacctgttagtgaaaaaatacctgaagatttctttgattttgataaa
aagaaggatgaattgactacagaagagttaaagagaatgttgtatgaagaaatcatgaaa
cctttgtag

DBGET integrated database retrieval system