KEGG   Candida orthopsilosis: CORT_0B01250Help
Entry
CORT_0B01250      CDS       T02488                                 

Definition
(RefSeq) Cek1 protein kinase
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:259165..260313
Genome map
AA seq 382 aa AA seqDB search
MSVEHHPQQHHQAQIQQQMQQQQQQQQSETPQRQVSFNVSDHYQILEIVGEGAYGIVCSA
IHKPSQQKVAIKKIEPFERSMLCLRTLRELKLLKHFNHENIISILAIQRPYDYAHFNEIY
LIQELMETDLHRVIRTQTLTDDHIQYFTYQTLRALKAMHSANVLHRDLKPSNLLLNSNCD
LKICDFGLARSIASSEDNFGFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEML
SGRPLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSLPFCKKIPFAELFKNV
NNAPINPLALDLLEKLLIFNPAKRITMEDALKHPYLQLYHDPNDEPVSEKIPEDFFDFDK
KKDELTTEELKRMLYEEIMKPL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgaacatcatccccaacagcaccatcaagctcaaatccaacagcagatgcaa
caacaacagcagcagcagcaatcagagaccccacagagacaggtatcttttaatgtttct
gaccactatcaaatactagagattgtcggtgagggagcttatggtatagtttgttcagcc
attcataaaccatcgcaacagaaagtagccatcaagaaaatcgaaccatttgaaagatca
atgttgtgtttgcgaacattacgtgagttaaaacttttaaaacatttcaatcatgaaaat
atcatatcgatacttgctatacaacgaccatatgattatgcccattttaatgaaatttac
ttgattcaagaattgatggagactgatttacatcgagtgatacgtacacaaaccttgact
gatgatcatatacagtatttcacgtatcaaaccttacgagctttgaaagccatgcattca
gctaacgtattacatcgagatttaaaaccactgaatttattactaaactctaattgtgat
ttgaaaatttgcgattttggtcttgctagaagtatcgcatcactggaagataattttgga
ttcatgacggaatacgtcgctactcgatggtatagagcccctgaaatcatgttgactttt
caagaatataccacggcaattgatgtttggtcagtagggtgcatattggcagaaatgttg
agtggtagacctttgtttccaggaagagattatcacaatcagttgtggttaattatggaa
gtgttaggtacccccaacatggaagattactataatatcaaatcgaaacgagcaagagag
tatattcgatcattaccattttgtaaaaagattccatttgctgaattgttcaaaaatgtt
aataatgcacctataaatccactagcgttggatttattggaaaaattacttatatttaat
cctgctaaacgtatcaccatggaagacgctttgaaacacccatatttacagttatatcat
gatccaaatgatgaacctgttagtgaaaaaatacctgaagatttctttgattttgataaa
aagaaggatgaattgactacagaagagttaaagagaatgttgtatgaagaaatcatgaaa
cctttgtag

DBGET integrated database retrieval system