KEGG   Candida orthopsilosis: CORT_0B01630Help
Entry
CORT_0B01630      CDS       T02488                                 

Definition
Hos1 histone deacetylase
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
cot  Candida orthopsilosis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:347386..348582
Genome map
AA seq 398 aa AA seqDB search
MNHIILTHSDLLTTLADELPCNKQRQSFVQGLLHAYKLDQQVEILPIIPIEWALLEQYHD
TDFIKELQRPRDDLDKQSEDYKEIMESVSEEFEGLGDKEDELLDDSNDEKYGLAFDCCPF
PFMRYYVNLTAASTIQLARKIAHSSIEIGSGRVIGINWYGGRHHCHRSKCSGFCYINDIV
LGITTIRKMFSGNVFYLDLDLHNGDGVAEAFKYSKKVATCSVHRCDVGFFPAGSGKLEDS
VSGMYNVPTKRGLTDEGMLWILQNVVFHLIDKHQPEYLVVQLGCDGLNTDPSNEWNMTIQ
GYSETIRLLIERVNIPVMVLGGGGYNYTEVAKCWTYVTGALLGYSADNFDEIPEHKLLDH
YEVDGYRFWTDSNLQSGKMKNENDLEYLQCLQKHLLSL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatattatcctcacacattctgatttattaactacactagctgacgaactaccg
tgtaacaaacaacgacagtcatttgttcaaggtttacttcatgcttataaactagatcag
caagtcgaaatcttaccaattattcccatcgaatgggcattattggaacaataccatgac
acagatttcataaaggagttgcaacgacctagagacgatcttgacaagcaatcggaagat
tacaaagagattatggagtctgtatctgaagaatttgaaggtttgggtgataaggaagac
gaattgcttgatgacagtaatgatgaaaaatacggacttgcattcgattgttgtccattc
ccatttatgcgttattacgtgaatttaactgctgcttctacaatacaactagcaagaaaa
atagcgcacagttccatagaaattggatctggtagggtcatcggaataaattggtatggt
ggtagacaccattgtcatcgctctaaatgctcaggtttttgctacataaacgacatcgtt
cttggaataaccaccattcgcaagatgttttccggtaatgttttctatttagatttggat
ttgcataatggtgatggagtggctgaagcatttaaatattcaaagaaagttgcaacttgt
tcggtgcatagatgtgacgttgggttttttccagcagggtcaggaaagttagaggattct
gtttctgggatgtataatgtacctacaaagcgaggtttgaccgatgaaggtatgttatgg
atcctccagaatgtagtatttcacttgatcgataagcatcaaccggagtacttggttgtg
caattaggatgtgatgggcttaatacagaccctagtaatgagtggaacatgacaatccag
gggtatctggagacaatacgattattgattgagagagtaaacataccagttatggtgcta
ggtggtggaggttacaactacaccgaggttgctaaatgttggacctatgtaactggtgca
ttgttgggttacagtgctgacaatttcgacgaaattcctgagcataaactactcgaccat
tatgaagtcgatggttatagattctggactgattccaatctacaactgggtaaaatgaag
aatgaaaatgatttggaatatttgcaatgtttgcagaagcatttgctatctctataa

DBGET integrated database retrieval system