KEGG   Candida orthopsilosis: CORT_0B03610Help
Entry
CORT_0B03610      CDS       T02488                                 

Definition
Cdc9 protein
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
cot  Candida orthopsilosis
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:cot00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CORT_0B03610
   03410 Base excision repair
    CORT_0B03610
   03420 Nucleotide excision repair
    CORT_0B03610
   03430 Mismatch repair
    CORT_0B03610
Enzymes [BR:cot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CORT_0B03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:786744..789026
Genome map
AA seq 760 aa AA seqDB search
MNYLREGRVNLISTLIKRGNYQYRIMAQQQSIARFFGGTASLDAKRKKTSSPPSTQKEST
TTPKNLKSSDPITSPDSSPKLKKQKLNGEENKDDADSKSESNSDSELNNKHASETEAKKL
IELSEFQQKQNKQDRHTLSSSKIPYSSLTDIMEKIESESSRLKITAIISQYFLEILQSQN
EVSKLVKIVYLFINRLGPDYEPDLELGLGETLLVKAISEGYGRTPAKIRQDLKEYGDLGI
VAQKSRSGQRTMFKPTSLDVDTVFDNLTKIAKSTGKDSQSKKIGIINKMLTACDVKHSEA
KFLIRSLENKLRIGLAGPTILVGLAQAFVNYENSKQEKPKRVSPEKLAEAEDIVKEAYTR
IPNYQILIENAYKYGVFNLLDHCKLTPGIPLKPMLAKPTKSMSEVLDRFQDEKFTCEYKY
DGERAQIHLLPNGDVRIYSRNSEDMSQRYPDLISIIREFSKAQEHTSLILDCEAVAWDRI
NKKILPFQVLSTRKRKDVNELDITVHICLFAFDLLYYNNESLLTKSLSERRSIMFTHLHP
LEGKFQFATSKDSTSLEVLQQFLDQSVHDSCEGLMVKMLEGSESYYEPSKRSRNWLKLKK
DYLAGVGDSLDLVVIGAYNGKGKRTGTYGGFLLATYNQDTGDLETTCKIGTGFSDEMLTQ
LYQKLHPSEIPRPKEYFVYDKTNSNAVPDVWFEPTMLFEVLTADLSLSPIYKAAHNEYGK
GISLRFPRFLRIRDDKAIEDATSSTDVAEFYERQAHVQNI
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttaagagaaggcagggttaatttaatatcaacgttaatcaagaggggaaat
tatcaatatagaatcatggcacaacaacaatcgattgcacgtttctttggtggaactgct
tctttagatgctaagagaaagaaaacatcgagtccaccatctacacaaaaggaatccact
acaacaccaaagaacttaaaaagttctgatccgattacatcgcctgattcatcgccaaaa
ttgaagaaacaaaagttgaacggtgaagagaacaaggatgatgctgacagcaaaagtgag
tcgaattctgattctgaattaaacaacaagcacgcttcagagacagaggcaaagaaacta
attgaactaagtgaatttcagcaaaaacagaacaaacaagacaggcacacattatcatca
ctgaaaattccttattcatcattaactgatataatggaaaagattgagtcggaatcatca
cgattgaaaatcacggcaattatatcacaatactttctcgaaattctccaatcacaaaat
gaggtgtcaaaattagtcaaaattgtttatttattcatcaatagattaggtcctgattac
gaacctgatttggaacttggcttaggtgaaacattattggtgaaagctataagtgaagga
tacggacgtacacccgctaaaatcagacaagatttaaaagagtatggagatttaggaatt
gttgctcagaaatcacggagtggacaacgaacaatgtttaaaccaactagtctagatgtt
gatacagtatttgataatttgacaaagattgccaaatccacgggaaaagactcccaatca
aagaaaattggaattattaataaaatgttaactgcttgtgatgttaaacatagtgaagcg
aaatttctaatacgttcattggagaacaaattaagaattggattagctgggcccacgata
ctagttggattagcccaagcatttgtaaattatgaaaatctgaagcaagagaaaccaaag
agggtgagtcccgagaagttagctgaagctgaggatatcgtcaaggaagcatacacaaga
attcccaattatcaaatcttgattgaaaatgcatacaaatatggtgtattcaacttgttg
gaccattgcaaattgacacctggtattcccttgaaaccaatgttggccaaacccactaaa
tcaatgagtgaagtattggatcgtttccaagatgaaaaattcacttgtgaatataaatat
gatggagaacgagctcaaattcatttgttgcctaatggcgatgtacgtatttactcgaga
aattcagaggatatgtcacaacggtatcccgatttgatttctattataagagaatttagt
aaagctcaagaacacacttcattgattttggattgcgaggctgttgcatgggatagaatc
aacaagaaaattttaccatttcaagtactttcgacgaggaaaagaaaagatgttaacgag
ctagacatcactgtccacatttgcctttttgcgtttgatttgctttactacaataatgaa
tctttgttaactaagtcgttactggaaagaagatcaatcatgtttactcatcttcatccc
ttagaaggcaaatttcaatttgccacatcaaaggattcaacttcattagaagtccttcaa
caattccttgatcaaagtgtccatgattcatgtgaaggtctaatggtgaagatgcttgaa
ggttccgaatcgtactacgagccatcgaagagatcacgtaattggttgaaattgaaaaag
gattatttagctggagtgggcgattcattggatcttgttgtcattggtgcatataatgga
aaggggaaacgtacaggaacttatggtgggttcttacttgctacatataatcaagatact
ggagatttagaaactacatgtaagatcggtactgggttcagtgatgaaatgttgacacaa
ttgtatcagaaattgcacccactggagatccctagaccaaaggagtattttgtatatgac
aagacaaactccaatgcagtgcctgatgtgtggtttgagccaacaatgttgtttgaggta
ttgacggccgatttatccttgagtccgatatacaaagcagctcataatgaatatggaaag
ggaatcagtttgaggttccctcggttcttacgaattagagatgataaagcgattgaagat
gctaccagttcaaccgacgttgctgagttctacgaacgtcaagcacatgtacaaaatatt
taa

DBGET integrated database retrieval system