KEGG   Candida orthopsilosis: CORT_0B06480Help
Entry
CORT_0B06480      CDS       T02488                                 

Definition
Icl1 isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cot  Candida orthopsilosis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CORT_0B06480
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CORT_0B06480
Enzymes [BR:cot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CORT_0B06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1371093..1372730)
Genome map
AA seq 545 aa AA seqDB search
MAYTPIDLKKEEQDFQKEVAEIKKWWAEPRWRKTKRIYTAEDIAKKRGSLKINYPSSQQA
DKLFALLEKHDANKSVSFTFGALDPIHVTQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQKEERLSMSPEERAKTPYIDFLRPIIADADTGHGGL
TAIIKLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADIFGS
NLLAVARTDSEAATLITSTIDHRDHYFIAGATNPESGDLVQLLVEAEGRGATGDELAAIE
AEWTKKAGVKLFSEAVIDEIKNGSYSNKDQLIKQFTDKVNPLSETSNKEARKLAKELLGK
DIYFNWEVSRAREGYYRYKGGCQCAVMRGRAFAPYADLIWMESALPDYAQAKEFADGVKS
AVPDQWLAYNLSPSFNWTKAMPADEQETYIKRLGELGYVWQFITLAGLHTTALAVDDFAN
NYAKIGMRAYGSQVQEPEIAKGVEVVKHQKWSGASYIDGLLKMVSGGVTSTAAMGAGVTE
DQFKN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcttacactccaatcgatttaaaaaaggaagaacaagacttccaaaaagaagttgct
gaaatcaagaaatggtgggcagaaccaagatggagaaaaaccaagagaatctatactgct
gaagatattgctaaaaagagaggatctttaaagatcaactacccatcctctcaacaagct
gataaattgtttgctcttttagaaaaacatgatgctaacaagtctgtttccttcactttc
ggtgctttggacccaatccacgttacccaaatggctaaatacttggactccatttacgtt
tctggatggcaatgttcttcaactgcttccacttcaaacgaaccatcaccagatttggct
gattacccaatggacactgttccaaacaaggttgaacatttgtggtttgctcaattgttc
cacgacagaaaacaaaaggaagagagattgtctatgtccccagaagaaagagctaaaact
ccttacattgactttttgagaccaatcattgccgatgctgatactggtcacggtggttta
actgctatcatcaagttgaccaaattgtttattgaaagaggtgctgctggtatccatatt
gaagatcaagctccaggtaccaagaaatgtggtcacatggctggtaaggttttggttcca
gtccaagaacacattaacagattggttgccattagagcatctgctgatatcttcggttcg
aacttgttggccgttgctagaactgattcagaagctgctactttgatcacttctactatc
gaccacagggaccactactttattgctggtgccactaatcccgaatcaggtgacttggtt
caattattggttgaagctgaaggaagaggtgctaccggtgacgaattggctgctattgaa
gctgaatggaccaagaaggctggtgtcaagttgttctccgaagctgttattgacgaaatt
aagaacggttcatactccaacaaggaccaattgattaaacaattcacagacaaggttaac
ccattgtctgaaacttccaacaaagaagccagaaagttggctaaagaattgctcggaaaa
gatatttacttcaattgggaagtctcaagagctagagaaggttactacagatacaagggt
ggttgccaatgtgcagttatgagaggtagagcttttgctccttatgctgatttgatctgg
atggagtcagcattgccagattatgctcaagctaaggaattcgccgatggtgttaaatca
gcagttcctgaccaatggcttgcttacaacttatcaccatcattcaactggaccaaggct
atgccagctgacgaacaagagacttacatcaagagattgggtgagctcggttacgtttgg
caattcatcactttggctggtctccatactactgctttggcagttgatgatttcgccaac
aactacgccaagattggtatgagagcatatggttctcaagttcaagaaccagaaattgcc
aagggtgttgaagttgttaagcatcaaaaatggtctggtgccagctacattgacggtttg
ttgaagatggtctctggtggtgtaacgtcaaccgctgccatgggtgctggtgtcaccgaa
gatcaattcaagaattaa

DBGET integrated database retrieval system