KEGG   Candida orthopsilosis: CORT_0C00320Help
Entry
CORT_0C00320      CDS       T02488                                 

Definition
(RefSeq) Rpd31 histone deacetylase
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cot  Candida orthopsilosis
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cot00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CORT_0C00320
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CORT_0C00320
Chromosome [BR:cot03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CORT_0C00320
   HDAC complexes
    Sin3A-HDAC complex
     CORT_0C00320
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CORT_0C00320
  Chromatin remodeling factors
   NuRD complex
    CORT_0C00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3:49238..50902
Genome map
AA seq 554 aa AA seqDB search
MASTINSMKKNLAKPAIGKQKSFTPAITKIFILQLHPFAMYTQLPFDELKVDPNQKKRIA
YFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEY
IDFISRVSPDNLDMFSKESVKFNVGDDCPVFDGLFEYCGISGGGSMEGAARLNRGKCDIA
INYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDR
VMTCSFHKYGEFFPGTGELRDIGVGKGKYHSVNVPLRDGIDDATYKSIFEPVITKIVEWY
QPSAIVLQCGGDSLSGDRLGCFNLSMEGHANCINFVKSLNIPLMVLGGGGYTMRNVARTW
AYESGLLNNVKLPAELPYNEYYEYYAPNYTLEVRPSNMYNQNSPEFLDKVMTSIVANLEN
TKHAPSVQMNDVPNDPEDLGDIEEDNVEAIDTKGGSEMSRDAQVQPENEFYDEDDKDAGE
KNIEENGKREESNGQSSKANAPEEEDVKMDDGDDTQNNTVEEDKTKDETADVSMLTEEEL
KEIEAMNEAALKNE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggctagtaccataaatctgatgaagaaaaatttggcaaaaccggcgataggtaaacaa
aaaagtttcacgccagcaatcactaagatctttattttacagctccaccctttcgctatg
tacacgcagctcccgtttgacgaactcaaggtcgaccccaaccaaaagaaaagaatagct
tatttttacgacgctgatataggaaactatgcttatggtgccggacatccaatgaaaccc
catcgtataagaatggcacattctcttataatgaattatggactttacaaaaagatggaa
atctatcgtgccaagccagctacaaaacaagaaatgtgtcaattccatactgatgagtat
attgatttcataagtcgagtgtcacctgataacttagacatgtttagtaaagaaagtgtt
aagtttaatgttggtgatgattgtcctgtatttgatggattatttgagtactgtgggatt
agtggtggtggatcgatggaaggtgcagcaagattgaatcgaggcaagtgtgatattgcc
attaattatgctggtgggttgcaccatgctaaaaaatcagaagcatcggggttctgttac
ttgaatgacatagtgttgggtataattgaattattgagatatcatcctagagtattgtat
attgatattgatgttcatcatggtgatggggttgaagaagcattttacacaactgatcga
gtgatgacatgttcattccacaagtatggtgagtttttccctggaactggtgaattgaga
gacattggagttgggaagggaaaataccatagtgttaatgttcctttgagagatggtatt
gatgatgctacatacaaatccatttttgagccggtgattaccaaaattgtagaatggtat
caaccatcagctattgtgctacaatgtggtggtgattccttaagtggtgacagattggga
tgctttaatttatcaatggaaggtcatgctaattgtatcaatttcgttaaatcactcaat
atcccattgatggtgttgggtggtggtgggtacactatgagaaatgtggctagaacatgg
gcttatgaatcagggttattgaacaatgtcaaattgccagcagagttaccgtacaatgaa
tattatgaatactacgcaccaaactatactttagaagtgcgtccatcaaatatgtataat
caaaattcgcctgagttcttggacaaggttatgacaagtattgttgccaatttagaaaac
actaagcatgcgccatcagtacaaatgaatgatgtgcctaatgatccagaagatttgggt
gatatcgaagaagataatgtggaagcaattgatactaaaggtggatcagaaatgagtcga
gatgctcaagtacaaccagaaaatgagttttatgatgaggacgataaagatgcaggggag
aagaacatcgaggaaaatggtaaaagagaagaaagtaatggacaaagtagtaaagctaat
gctcctgaagaagaggatgtgaaaatggatgatggagatgacacgcagaataacactgtt
gaggaagacaaaacgaaagatgaaactgctgatgtttcaatgttgacggaagaagaattg
aaagaaattgaagctatgaacgaagcagctttgaagaatgagtaa

DBGET integrated database retrieval system