KEGG   Candida orthopsilosis: CORT_0C00460Help
Entry
CORT_0C00460      CDS       T02488                                 

Definition
Pmt2 hypothetical protein mannosyltransferase (PMT)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cot  Candida orthopsilosis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CORT_0C00460
Enzymes [BR:cot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CORT_0C00460
Glycosyltransferases [BR:cot01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CORT_0C00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(83861..86152)
Genome map
AA seq 763 aa AA seqDB search
MSSSAQPHQTQVKPTRNLHKDDTITSIDSKYETDDAELLKRSQYDEVSETIESWKKLESI
LAPLLFTLLSFFVRFYRISINDSVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG
YLAGYNGSWDFPSGEKYPEYIDYTKMRLFNATFSALCVPFAYYTMKEIGFSVWTTWLFTL
MVTLESSYVTLGKFILLDSMLLFFTVTTVFCFARFNNFNVKESEFSRKWWKWLLLTGVSI
GCVCSVKMVGLFVTTLIGIYTVVDLWNKLNDRSITWIRYGYHWAARIFGLIIIPISIFLL
CFKVHFDLLYKSGPGDANMSSLFQANLLGSQVGGGPREISMVHSVVTLKNQGLTGGLLHS
HVQTFPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPSYDPSGNNTDIEYVFDGMPIRIMHP
QTGRNLHTHEIPAPVTKTELEVACYGNLTVGDAKDNWIVEVADQASNEDKMRLHPLTTSF
RLKNEVMDCYLGVSGSTLPQWGFRQGEVVCFKNPFKKDKRTWWNIEDHRNELLPPAPEDF
KLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQWPTLNVGIRMCGWGADKPK
YFMIGSPATTWSSSIGIIVFALITLYYLVRWQRQIVDYPSDQPARLQKFIMGGIYPMLGW
GLHFMPFVIMGRVTYVHHYVPALYFAMIVFCFEVELWTSKLNYRGASAVSKIAYIAIYLA
LYFIVGFTFYYLRYFSFGMEGPKENWKHTQWLQSWRVSDDNYV
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatctgcacaaccacatcaaacgcaggtgaagccaacgagaaacttgcacaag
gatgatactatcacgtcaattgattccaaatacgagactgacgatgcagaacttctcaag
agaagtcaatatgacgaagtgtcagaaacaattgaatcatggaaaaaattagaatcgatt
ttggcgcccctcttgttcactttattatcattttttgttcgattttatcgtatttcaatc
aatgatagtgttgtttgggatgaagctcatttcggtaaatttggttcttattacttacgt
catgaattttatcatgatgtccatccaccattgggtaaaatgttggttggattgtcgggg
tatttagctgggtataatggatcatgggattttcctagtggtgaaaaataccccgaatat
atcgattataccaaaatgaggttgtttaatgctacgttttcagcgttgtgtgttccattt
gcgtattataccatgaaggaaattgggttttctgtgtggacgacttggttatttaccttg
atggttactttggaaagttcttatgttactttgggtaagtttattttgttagattcgatg
ttgttgtttttcacagtgactacggtgttttgttttgctagatttaataattttaatgtt
aaggaaagcgagtttagtaggaaatggtggaaatggcttttgttgactggtgtttctatt
ggatgtgtctgttcggttaaaatggtgggattgtttgtcactactttaattggtatttat
actgttgttgatttgtggaataaattgaatgataggtcaattacctggattaggtatggg
tatcactgggcagcgagaatttttggattgattattatcccaatttcaattttcttgctt
tgttttaaagttcatttcgatttgttgtacaaatcgggtcctggtgatgctaatatgtct
tctttgtttcaagctaatttacttggatcacaagttggtggaggtccaagagaaatttcc
atggttcattcagttgtcacgttgaaaaatcaaggattgactggaggacttttgcactca
catgtgcaaaccttccctgaaggttctaaacaacagcaagttactacttatggacataaa
gattccaataacaattggattttccaacgtccaagaggtcaaccaagttatgatcctagt
ggaaacaataccgatatcgaatatgtgtttgatggtatgccaattagaattatgcatcca
caaactggaagaaacttgcacacccacgaaattccagcccctgttaccaagactgaattg
gaagttgcatgttatggaaacttaaccgttggtgatgctaaggataattggattgtcgag
gtcgctgatcaagctagtaatgaagacaagatgagattacatccattgacaacatcattc
agattgaaaaatgaagttatggactgttatttaggagtttcgggatctactttaccacaa
tgggggtttagacaaggtgaagttgtatgttttaagaacccattcaagaaggataagaga
acgtggtggaatatcgaagatcatagaaatgaacttttacctccagcaccagaagatttc
aagttacccaagacaagatttattcgtgattttatccaattgaatttagccatgatggct
acaaacaatgcattgttgcctgatcctgataagcaggatgatttggcttcttctttctgg
caatggcctaccttaaatgttggtattagaatgtgtggatggggagccgataaacctaaa
tactttatgattggatcacctgcaactacatggagttccagtattggaattattgtgttt
gccttgattacattgtactatctcgtcagatggcaaagacaaattgtcgattacccaagt
gaccaaccagcaagattacaaaaatttataatgggtggtatttatccaatgttgggttgg
ggtttacattttatgccatttgtcataatgggaagagtaacttatgttcatcattatgta
ccagcattatactttgccatgattgtattctgttttgaagttgaattatggacttcgaaa
ttgaactacagaggagcttcagcagtaagcaagattgcatatatagcaatttatttggca
ttgtattttattgttggttttacattttattatttgaggtatttctcatttggaatggaa
ggtcctaaggagaattggaaacatactcaatggttacaatcatggagagtttctgacgat
aattatgtatag

DBGET integrated database retrieval system