KEGG   Candida orthopsilosis: CORT_0C01800Help
Entry
CORT_0C01800      CDS       T02488                                 

Definition
Cki1 protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cot  Candida orthopsilosis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CORT_0C01800
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CORT_0C01800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:384504..386171
Genome map
AA seq 555 aa AA seqDB search
MEISPASLTPRPRSRSRTRNSTANSRSTSATRRPSLSGTRKSLSSSSLNKLTITPTQIDD
ERSVPSVQAVLDNSLPADFFKQDIIALTKALRIHKWHKRNLNIHKLKITRISGALTNSIY
KIDYVDEEQDIHLPSLLLRVYGKNVDELIDRDSELMTLIKLSQKRIGPRLLGIFTNGRFE
QFLEGFVTLTKDQIRDQVISQMIGRRMKDLHYKVELTKEESNSPVPTCWRLIEKWLKIFE
TEYKPGYEKAGVELEDIFMMDFDSFKKLVFKYKDWLFDKYKEDGFSSNYKFCHNDTQYGN
LLLHNSFEPEEIVIDTPLGSSTNLPEVAIKSTSNKKDSNLVVIDFEYSGPNFPAFDIVNH
FSEWMSNYHDPERSYFINDTMFPTQLEQLNFIKAYIEYDFQLPSSNLKSAKSDGELLNSS
DKQAVSIIQYEIEKMFNECIYWRSSVQIFWALWGLIQNGPIEPRPEMSRKESEQGVDSTY
NITVEMEKFGLQDLEITAGDAITSSDDDFDYLKYSNQKIAIVVGDSIQFNLLDKDRVDSK
YHEDIKYLSSKTYDL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggagatttcaccagcaagcttaacgccgagaccaagatcaaggtcaagaactagaaac
tcaacggccaactcaaggtctacttcagccacaagaagaccgagcttgtcaggaacaaga
aagtcgctatctagttcttcgttgaataaattgaccatcacaccaactcaaattgatgac
gagcgttcagtaccatcagtgcaagcagttttggacaactcgttacctgccgattttttt
aagcaagacattatagcattgactaaagcattgagaattcataaatggcataaaagaaat
ttgaatattcataagctaaaaatcacgagaatttcgggagctttaaccaattccatctac
aaaattgattatgtggatgaagaacaggatattcatttgccttcattgttgttgagagtt
tatggaaagaatgtcgatgagttgatcgacagagatagtgaattaatgactttgattaag
ttatcacaaaagcgtattggccctagattattgggtatatttactaatgggagatttgaa
cagtttttagaaggatttgtcactttgacaaaagatcaaattagagaccaagtgatttcc
caaatgattggaagaagaatgaaagatttgcattacaaggttgagttgaccaaggaagag
tcaaattcaccagtacctacatgctggagattgattgagaaatggctcaaaatatttgag
actgaatataagcccggatacgaaaaagcaggcgtcgaacttgaggatatctttatgatg
gattttgacagcttcaaaaagttggtattcaagtataaggattggttatttgacaagtac
aaagaggacggattttcttcaaattacaaattttgccacaacgacacccaatatggaaac
ctacttctccacaactcatttgagcccgaagaaattgttattgacacaccgcttgggtcc
agtacaaatttacctgaggttgccatcaagtccacctctaacaaaaaggattccaatttg
gtggtcatcgattttgagtactcaggacccaacttccctgcatttgacattgtcaaccat
tttagtgagtggatgtctaattaccatgatccagaaaggtcctacttcatcaatgacacg
atgtttcccacccaattggagcagttaaacttcatcaaagcttacatagaatacgatttc
caattaccatcatcaaatttgaagtcagcaaaatcagatggagagttgttgaatagctcg
gataagcaagcagttagcattattcagtacgagattgaaaaaatgtttaatgaatgtatc
tactggcgctcatcggtgcaaatattttgggcactttgggggttgatccaaaatggacct
attgaaccaaggccagagatgagtagaaaggaaagcgagcaaggtgttgacagtacatac
aacatcacagttgagatggagaaatttggacttcaagatttagaaattactgctggtgat
gccataacttcgagtgatgatgattttgactatttgaagtatagtaaccaaaaaatagca
attgttgtaggagattccatacagttcaacttgctcgataaggatagggttgattctaaa
tatcatgaagatatcaagtacttgagttcgaaaacttatgatttataa

DBGET integrated database retrieval system