KEGG   Candida orthopsilosis: CORT_0C02420Help
Entry
CORT_0C02420      CDS       T02488                                 

Definition
Elp3 protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CORT_0C02420
Transfer RNA biogenesis [BR:cot03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CORT_0C02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:517601..519250
Genome map
AA seq 549 aa AA seqDB search
MPSQNKAKQVPEKERFIQCCADISLDLVASLKSSKDINLNGLITRYAKKHKLKSQPRLTD
IISSIPDQHKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVDQLRSLGHSIDKVEYIIMGGTFMSLPI
DYRENFITQLHNALTGFNGKDIDEAIEFSQQSQTKCVGITIETRPDYCTETHLSDMLKYG
CTRLEIGVQSVYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDLPNVGMERDLE
QFKEYFENPDFRTDGLKLYPTLVIRGTGLYELWKQGLYKSYNANALIDLVARILALVPPW
TRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTREVGIQEVHHKVVPDQ
VELIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTKQQTSIVRELHV
YGSVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSSKISVISGVGVRNYYAKLGYEL
DGPYMSKML
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacaaaataaagcaaaacaagtgcccgaaaaggaaaggtttattcaatgttgt
gccgatatttcactcgacttggttgcatccttaaaatcatcaaaagatatcaacttgaat
ggacttattacccgatatgccaaaaaacataaactcaagagtcagccacgattaactgat
attatatcctcgatacctgatcaacataaaaaataccttatacctaaattgaaagctaag
cccgtacgtacggcttcggggattgcggttgtcgctgtcatgtgtaaaccccatagatgt
cctcatattgcttatactggtaacatttgtgtttattgtcctggaggacctgattcagat
ttcgaatattcaacccaatcttatacgggttatgaacctacttcaatgagagccattaga
gcaagatacgatccttacgagcaagctagaggtagagttgatcagttgaggctgttgggt
cattccatcgataaagtggagtatattattatgggaggtacttttatgtcgttaccaatc
gattatcgtgagaatttcattacccaattacacaatgcccttactggtttcaatggtaaa
gacattgatgaagccattgagttttctcaacaatcacaaaccaaatgtgtaggtatcacc
attgaaacaagaccagattattgtaccgaaacacatttaagcgatatgttgaaatatgga
tgtacgcgattggagattggtgtacaaagtgtttatgaagatgttgctagagatactaat
cgtggtcatactgtcaaagctgtttgtgaaacattcgcagttgcaaaagatgcaggttac
aaagtagttagtcatatgatgcctgatttacctaatgtaggaatggaacgagatttggag
caatttaaagagtattttgaaaaccctgatttcagaactgatggattaaagttataccct
acattggtcattagaggtacagggctatatgagttatggaaacaggggttgtacaagtct
tacaatgccaatgcattgattgacttagttgctaggatattagcattggttccaccatgg
actcgtatctaccgtgtgcaaagagatatccccatgcccctcgtcacatcgggtgttgaa
aatggtaacttacgtgaattggccttggcaagaatgaaggatttcggtacatcatgtcgt
gatgtacgtacacgtgaagttggtattcaagaggttcatcataaagttgttcctgatcaa
gttgaactaattcgtcgtgattactatgccaatggcggttgggaaacatttttaagttat
gaagatccaaaacaagatatccttattggattgttacgtttaagaaaagctagcaagaag
tacacttatagaaaggagttcacaaaacaacaaacttctatagttagggagctacatgtt
tatggatcagttgttcctttgcattctagagatccaaggaaatttcaacatcaaggattt
ggtacattattgatggaagaagcagcaaggattgctaaagaagaacatggttcactgaag
attagtgttatctccggggttggtgtaaggaactattatgctaaattggggtatgagtta
gacggcccgtacatgtcaaagatgctttag

DBGET integrated database retrieval system