KEGG   Candida orthopsilosis: CORT_0C02710Help
Entry
CORT_0C02710      CDS       T02488                                 

Definition
Dfg10 protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CORT_0C02710
    1.3.1.94  polyprenol reductase
     CORT_0C02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:591103..592113
Genome map
AA seq 336 aa AA seqDB search
MLMPWGHISVDVTSCYTVLGIFYQRVNIYRDLFIFSVPLFSQSITFYMNITTTYNLQLLV
SLAYFVLTSGILLVKYVPPLKRLLNYGKTVPDFDSRGNNSPSSPSTPSEVIDIIAKYAVV
RKSWFTHFYICLFTLSTATYFKACHEAIIGQSDNEAATFKNLETINKLLLLQGARRMIES
FVVTKFSTTSYMNITHYVVGISHYVLIALATYLGLSGSCAGSAVLTIADYMLIAIFGVAS
LQQFRAHYHLAHLVKYSLPKFKLVASPHYLYEVIIYTVIMAFSTKNGINSTSFMFISGWV
FVVTNLSVSAVETYHYYQLKYKEEFDLKWAIFPGIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgccgtgggggcatattctggtggatgtgacatcttgctatactgtacttggt
atattctatcaacgggtaaatatttacagagacttatttatattttctgttccactcttc
tctcaatccataacattttatatgaatattactacaacttataacttacaattacttgtt
tcgctagcatactttgttttaacgtcaggtatattacttgtcaaatacgttccacctttg
aagagattattgaactatggtaaaactgttccggattttgattctagaggtaacaacagt
ccaagcagtcccagtacaccttcagaggtaattgacatcattgccaaatacgcagtggtg
cgtaagctgtggtttactcatttctacatttgcttgttcaccttatcaaccgctacatat
ttcaaagcatgtcatgaagccatcattggacaatctgataatgaagctgctacatttaag
aatttggaaaccatcaacaaactactccttttgcaaggtgccagaagaatgattgagagt
ttcgttgtaacaaagttttcaacaacttcgtatatgaacattacgcattacgtggttggt
atttctcattatgttttgattgcgttggctacatatttgggcttatcaggaagctgtgcg
ggaagcgccgttttaactatagcagactacatgcttattgctattttcggagttgcgtca
ctacaacaattcagagcgcattaccatcttgcccacttggtaaagtactcgctaccaaaa
ttcaagctagtagcatctccgcactacctatatgaagtcattatctacacagtgattatg
gcattcagtaccaagaacggaattaattcaacttcgtttatgttcatatcaggatgggta
tttgttgttactaatttatcagtttcggcagttgaaacgtatcattattatcaattgaag
tataaagaagagtttgatttgaagtgggctatatttccaggtattttgtag

DBGET integrated database retrieval system