KEGG   Candida orthopsilosis: CORT_0C03530Help
Entry
CORT_0C03530      CDS       T02488                                 

Definition
alanine transaminase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
cot  Candida orthopsilosis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cot01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:cot01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cot01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cot00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(803360..804982)
Genome map
AA seq 540 aa AA seqDB search
MITNMRSATLSTKFQFQPYGMVTRINNMLPTSATATPTPVGCRFKSSFVPAEPLNIHDLN
EQTVKAQYAVRGKIPIIADGLSDLIRKSPTSHGLPFNKIVNANIGNPQQLDQKPLTWYRQ
VLSILQYPELLKEDSGAKYPSDVKQRAKAILDNVGSIGAYSSSQGAAYFRQSIAEFITRR
DGGEFSSNANDIFLTSGASAAVSYLLQILSQDESSGFLIPIPQYPLYTATIALNDAQPIG
YYLDESKGWATNPQEIRQLIKESADKGIKIKALVVINPGNPTGAILSRDDIVELISIAAE
HGIVLIADEVYQENVFSGRFYSFKRILSELKEKHHDLYKHVQLASLHSTSKGVSGECGQR
GGYMELVGFKSDVKDVIFKLASINLCSVVSGQAMVELMVNPPKKGGESYDLYVKETTTVF
NNLKTRAEALYEAFLNMEDVSVDKPQGAMYIFPSLNFDPKVYHKLFSRAKNSSLEIDDLY
CIELLEHTGICCVPGNGFGQKPGTHHLRTTFLPPGEEWIQRWANFHKEFVKKYKDTAVSA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaatatgagatcagctaccttatcaacgaagtttcaatttcaaccctacggt
atggttacacgtattaataatatgctaccgacttccgccaccgccacccccaccccagta
ggctgccgttttaaatcatcatttgtccctgctgaaccattgaacattcatgatttgaat
gaacagacagtcaaagcccaatatgcagtgagagggaaaataccaattattgctgatggt
ttaagtgatttgattagaaaatcaccaacaagtcatggattgccatttaacaagattgta
aatgcaaatattggaaatccacagcaattggatcaaaaaccattgacttggtatagacaa
gtgttatccattttgcagtatcccgaattattgaaagaggatctgggagcaaaatatcca
tccgatgttaagcaaagagcaaaagctattttggataatgttggttccatcggtgcttat
tctctgtctcagggtgctgcttattttagacaatcgattgctgaatttattacaagaaga
gatggaggagagttttcttcaaacgccaatgatatctttttaacttcaggtgcatctgct
gctgtatcatacttgttacaaattttatctcaagatgaaagttcaggttttttgattcct
attccacagtatccattgtatactgccaccatagctttgaatgatgcacaacccattggt
tattatttggatgaatcaaaaggttgggcaactaacccacaagagatacgccaattgatc
aaagaaagtgctgacaaaggtatcaaaattaaagcattggttgtgattaaccctggtaac
ccaactggagcaatcttgtcgcgtgatgatattgttgaacttatctccatcgcggctgag
catggtatcgttttgattgctgatgaagtgtaccaagaaaatgtctttagtggaagattc
tattcctttaaacgtattttgtcggagttgaaggagaaacatcatgatttatacaaacac
gttcaattggcttctttgcattcaacttcaaaaggtgttagtggagaatgtggacaacgc
ggaggttacatggaacttgtgggatttaagtctgatgttaaggatgttatatttaaattg
gcatctatcaatttatgctcagttgtttcaggacaagcaatggttgagttgatggtaaat
ccacccaaaaaaggtggtgaatcatatgatttatacgtgaaagaaacaactacggttttt
aacaatttgaaaacaagggcagaagcactttatgaagcatttttaaacatggaagatgtg
tcagttgataaaccacaaggagcaatgtacatattcccaagtctcaattttgatcctaaa
gtttatcacaaattattttcaagagccaagaattcaagtcttgaaattgatgatttatac
tgtatcgagcttttggaacatactggtatttgttgtgttcccggtaatggatttggacaa
aaaccaggcacacatcatttgagaaccacatttttaccacctggtgaagaatggattcaa
agatgggctaactttcataaagagtttgttaagaaatataaggatacagctgttagtgca
taa

DBGET integrated database retrieval system