KEGG   Candida orthopsilosis: CORT_0C03530Help
Entry
CORT_0C03530      CDS       T02488                                 

Definition
alanine transaminase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
cot  Candida orthopsilosis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CORT_0C03530
   01210 2-Oxocarboxylic acid metabolism
    CORT_0C03530
   01230 Biosynthesis of amino acids
    CORT_0C03530
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CORT_0C03530
Enzymes [BR:cot01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CORT_0C03530
Amino acid related enzymes [BR:cot01007]
 Aminotransferase (transaminase)
  Class I
   CORT_0C03530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(803360..804982)
Genome map
AA seq 540 aa AA seqDB search
MITNMRSATLSTKFQFQPYGMVTRINNMLPTSATATPTPVGCRFKSSFVPAEPLNIHDLN
EQTVKAQYAVRGKIPIIADGLSDLIRKSPTSHGLPFNKIVNANIGNPQQLDQKPLTWYRQ
VLSILQYPELLKEDSGAKYPSDVKQRAKAILDNVGSIGAYSSSQGAAYFRQSIAEFITRR
DGGEFSSNANDIFLTSGASAAVSYLLQILSQDESSGFLIPIPQYPLYTATIALNDAQPIG
YYLDESKGWATNPQEIRQLIKESADKGIKIKALVVINPGNPTGAILSRDDIVELISIAAE
HGIVLIADEVYQENVFSGRFYSFKRILSELKEKHHDLYKHVQLASLHSTSKGVSGECGQR
GGYMELVGFKSDVKDVIFKLASINLCSVVSGQAMVELMVNPPKKGGESYDLYVKETTTVF
NNLKTRAEALYEAFLNMEDVSVDKPQGAMYIFPSLNFDPKVYHKLFSRAKNSSLEIDDLY
CIELLEHTGICCVPGNGFGQKPGTHHLRTTFLPPGEEWIQRWANFHKEFVKKYKDTAVSA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaatatgagatcagctaccttatcaacgaagtttcaatttcaaccctacggt
atggttacacgtattaataatatgctaccgacttccgccaccgccacccccaccccagta
ggctgccgttttaaatcatcatttgtccctgctgaaccattgaacattcatgatttgaat
gaacagacagtcaaagcccaatatgcagtgagagggaaaataccaattattgctgatggt
ttaagtgatttgattagaaaatcaccaacaagtcatggattgccatttaacaagattgta
aatgcaaatattggaaatccacagcaattggatcaaaaaccattgacttggtatagacaa
gtgttatccattttgcagtatcccgaattattgaaagaggatctgggagcaaaatatcca
tccgatgttaagcaaagagcaaaagctattttggataatgttggttccatcggtgcttat
tctctgtctcagggtgctgcttattttagacaatcgattgctgaatttattacaagaaga
gatggaggagagttttcttcaaacgccaatgatatctttttaacttcaggtgcatctgct
gctgtatcatacttgttacaaattttatctcaagatgaaagttcaggttttttgattcct
attccacagtatccattgtatactgccaccatagctttgaatgatgcacaacccattggt
tattatttggatgaatcaaaaggttgggcaactaacccacaagagatacgccaattgatc
aaagaaagtgctgacaaaggtatcaaaattaaagcattggttgtgattaaccctggtaac
ccaactggagcaatcttgtcgcgtgatgatattgttgaacttatctccatcgcggctgag
catggtatcgttttgattgctgatgaagtgtaccaagaaaatgtctttagtggaagattc
tattcctttaaacgtattttgtcggagttgaaggagaaacatcatgatttatacaaacac
gttcaattggcttctttgcattcaacttcaaaaggtgttagtggagaatgtggacaacgc
ggaggttacatggaacttgtgggatttaagtctgatgttaaggatgttatatttaaattg
gcatctatcaatttatgctcagttgtttcaggacaagcaatggttgagttgatggtaaat
ccacccaaaaaaggtggtgaatcatatgatttatacgtgaaagaaacaactacggttttt
aacaatttgaaaacaagggcagaagcactttatgaagcatttttaaacatggaagatgtg
tcagttgataaaccacaaggagcaatgtacatattcccaagtctcaattttgatcctaaa
gtttatcacaaattattttcaagagccaagaattcaagtcttgaaattgatgatttatac
tgtatcgagcttttggaacatactggtatttgttgtgttcccggtaatggatttggacaa
aaaccaggcacacatcatttgagaaccacatttttaccacctggtgaagaatggattcaa
agatgggctaactttcataaagagtttgttaagaaatataaggatacagctgttagtgca
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system