KEGG   Candida orthopsilosis: CORT_0C05230Help
Entry
CORT_0C05230      CDS       T02488                                 

Definition
Hem4 uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cot  Candida orthopsilosis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CORT_0C05230
Enzymes [BR:cot01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CORT_0C05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1210415..1211257)
Genome map
AA seq 280 aa AA seqDB search
MNNTVILLKNPSTPSDPYHDLLLANSYSPHFIPLLHHTHKDKAQTIAYLTSNEFVENTSN
FIITSQRAVEMLRECINELNEDHQANIRSKILNKVGYTVGPATHKILKEVGFVNVRGGID
AGNGSKLADLIMDELTPNTKIVFFTGEIRKDIIPRKLLDIGKFNQFEEFVMYQTCERDDI
IDKFNAVVEGVDGVGENGGEATASLHGWIVFFSPQGTKDIVEYLKESSNTVGASEGTRRW
KLASIGPTTEEYLLSHGLTPDTIAAKPDAASLVDGILKCD
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacagtcattctactaaaaaatcccagtacaccctcagacccctaccatgac
ttactcctagcaaattcgtacagtccccattttatcccattattgcatcatactcataaa
gacaaagcacaaacaatagcctatcttacatctaacgaatttgttgaaaacactctgaat
ttcataatcacctcacaacgtgcagtagaaatgttgcgcgaatgcatcaatgaactcaat
gaagatcatcaggcgaatatacgactgaaaattttgaataaagtggggtacacggtaggt
ccagcaactcacaagatattaaaagaagttggattcgttaatgtacgaggtggtatagat
gctggaaatggttccaaattagctgatttgatcatggatgaattgactccaaatacaaaa
attgtattttttactggtgaaattagaaaagatataattcctaggaaattgctagatatt
ggtaagtttaatcaatttgaagaatttgtcatgtatcaaacttgtgaaagagatgatata
attgataaattcaatgctgttgttgaaggagtcgatggagttggtgaaaatggtggggaa
gctacggccagtttacatggatggattgtatttttcagtcctcaaggaactaaagatatt
gtcgaatacttgaaagaactgagtaatactgttggtgcgtctgaagggaccagaaggtgg
aaattggctagtattggtcctaccactgaagaatatctcttatcccatggattaacacct
gatacaattgctgcaaaaccagatgctgccagtttggttgatggcatacttaaatgtgat
tag

DBGET integrated database retrieval system